KEGG   Torulaspora delbrueckii: TDEL_0G00620Help
Entry
TDEL_0G00620      CDS       T02236                                 

Gene name
TDEL0G00620
Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tdl  Torulaspora delbrueckii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tdl00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:127308..128039
Genome map
AA seq 243 aa AA seqDB search
MYHPQVEALQARQGTPLNTRPVSPYTLRLPVDEDGFSWPSVGTRERAQESEEQENARIER
ISGAVKTILEELGEDVTREGLLDTPTRYAKAMLYFTRGYQINIMDDVIKNAVFQEDHDEM
VIVRDIEIYSLCEHHLVPFYGKVHIGYIPNKNVLGLSKLARLAEMYARRLQVQERLTKQI
AMALSEILKPMGVAVVIEATHMCMVSRGIQKTGSATVTSCMMGCFRAHRTREEFLSLLGK
KSL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatccacaggtggaagctttacaggcaaggcagggcactcctttgaacacgaga
cctgtgtctccgtatactctgaggctaccagtcgatgaagatggattctcatggccctca
gttggtacgcgagagagggctcaggagtctgaggagcaggaaaacgcacgtattgaaagg
atatcaggagcggtaaagacgattttggaagaattgggtgaagatgttacaagagaaggt
ttacttgatactccaacccgttatgcaaaggcaatgctgtattttaccagaggttatcag
ataaatataatggatgatgtgattaaaaatgcagtttttcaagaggatcatgatgaaatg
gtcattgtgcgtgatatagagatatattcgctgtgcgagcaccatttggttcccttttac
ggtaaagtccacattggatacattccaaacaagaacgttctgggtttgagtaaactggct
agattggcggagatgtacgctagaaggttacaagtccaagaacggttgactaagcagatc
gctatggctttgagtgaaatcttgaagccaatgggtgtcgctgtagtgattgaagccacc
cacatgtgtatggtctctaggggtattcagaagactgggtctgctacggtaacatcctgc
atgatgggttgctttagagcacacagaacaagggaagaattcctgagtttgttgggtaag
aagagcctatga

DBGET integrated database retrieval system