KEGG   Torulaspora delbrueckii: TDEL_0G00620Help
Entry
TDEL_0G00620      CDS       T02236                                 

Gene name
TDEL0G00620
Definition
hypothetical protein
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
tdl  Torulaspora delbrueckii
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    TDEL_0G00620 (TDEL0G00620)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     TDEL_0G00620 (TDEL0G00620)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:127308..128039
Genome map
AA seq 243 aa AA seqDB search
MYHPQVEALQARQGTPLNTRPVSPYTLRLPVDEDGFSWPSVGTRERAQESEEQENARIER
ISGAVKTILEELGEDVTREGLLDTPTRYAKAMLYFTRGYQINIMDDVIKNAVFQEDHDEM
VIVRDIEIYSLCEHHLVPFYGKVHIGYIPNKNVLGLSKLARLAEMYARRLQVQERLTKQI
AMALSEILKPMGVAVVIEATHMCMVSRGIQKTGSATVTSCMMGCFRAHRTREEFLSLLGK
KSL
NT seq 732 nt NT seq  +upstreamnt  +downstreamnt
atgtatcatccacaggtggaagctttacaggcaaggcagggcactcctttgaacacgaga
cctgtgtctccgtatactctgaggctaccagtcgatgaagatggattctcatggccctca
gttggtacgcgagagagggctcaggagtctgaggagcaggaaaacgcacgtattgaaagg
atatcaggagcggtaaagacgattttggaagaattgggtgaagatgttacaagagaaggt
ttacttgatactccaacccgttatgcaaaggcaatgctgtattttaccagaggttatcag
ataaatataatggatgatgtgattaaaaatgcagtttttcaagaggatcatgatgaaatg
gtcattgtgcgtgatatagagatatattcgctgtgcgagcaccatttggttcccttttac
ggtaaagtccacattggatacattccaaacaagaacgttctgggtttgagtaaactggct
agattggcggagatgtacgctagaaggttacaagtccaagaacggttgactaagcagatc
gctatggctttgagtgaaatcttgaagccaatgggtgtcgctgtagtgattgaagccacc
cacatgtgtatggtctctaggggtattcagaagactgggtctgctacggtaacatcctgc
atgatgggttgctttagagcacacagaacaagggaagaattcctgagtttgttgggtaag
aagagcctatga

  All links  
No link information was found.   
DBGET integrated database retrieval system