KEGG   Torulaspora delbrueckii: TDEL_0G00730Help
Entry
TDEL_0G00730      CDS       T02236                                 

Gene name
TDEL0G00730
Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tdl  Torulaspora delbrueckii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:147888..152492
Genome map
AA seq 1534 aa AA seqDB search
MPVVYGPQPLRPLNLETRHGFDEQYSSEQYLQSLANDFIFYFDDKRHRTNGNPTPEEEKT
QDVNNYYQPIYDWKIMKERQKTVSAALLLCLNLGVDPPDVIKTHPCARTEAWVDPLNFQD
SKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKDDRILFHYNGHG
VPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIYVYDCNSAGNIVTNFQKFVQKRI
RDEEEGIPNAAAPSRASAYAECFQLASCRANELLLTSPELPADLFTCCLTCPIEISVRVF
LMQSPLKDSKYSIFFKSPSGDNTNESQNSFKANVPSVNIPGVLSDRRTPLGELNWIFTAI
TDTIAWTSLPRPLFKKLFRHDLMVAALFRNFLLAKRLMPWYNCHPVSDPELPDSIADHPM
WKSWDLALDEVLNKLVNDLKNAPPSADLETKMILQQQESLQTQQSQQQQQPQEMKSGSIQ
EKSRFAVANLSTMSLANHPAALAASKKSSGNVAQAAQQQQQQPQQQQFTGFFEQNLTAFE
LWLKYASNTRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL
KLLQSPAPELKPILVFIWARIMSIDYKNTQAELMKEKGYMYFVSVLVPDWGLNMSPTTGG
SLSAGSPLTMTASPSIHAPRGQHYQQQMANGFRASSPALHYPSSDTTDEQKAMSVFVLSS
FVRDFPLGQKNCFSLELVNKLCFYIDNSDIPLLRQWCIILIGQLCQQNPLNRYICMTAGI
IDTLVRSLKDPVPEVRTAVLLALKHFISDIDDGDNILKLQQDLEQHYQQLHTQFQQLQSS
AHQQQTQQIEHQQLKVEQQLQHCQVMQMQIQNIESRKLKRQEISNLVSVLALINDGSPLV
RKEVIIFFSQVVYRYINFFVVVAFNELTEEMIQMEGTDAEAQSYTDKHSISHGSVFTTVW
EALLILAEDPFSENRLLAGHVVEYILSELSVHKELSEAFSKMEQYLTKSGNNAHNGKTGF
SAAQVQVLKPTGPFSIEHSRQKETQKQEQNISHSKGNLGRIFRALGFKDLATEERETAHL
RNSRKTKSSGISLLSQPHGAAPLAKTVCAGRNKSTLKLPLESTFLDYSREYFQEPQMRKQ
EADEFGSVEYSSRLWRRNRNEMVIQETQAQKSLSLYGDWSNRWATLDNKTHPKVISFSQF
ENYLVSADERDIITVFDWEEKETLAKFSNGNPFGTKVTDLKFLNEDDAALLLAASSEGIV
KVYKNINASEDLEMITSWRGLTDMLLTPKSSGLLTEWQQIRGSLLATGDVKIIRIWDAHT
ETIEVDIPAKTSSLVTSITSDQLAGNVFVAGFAEGSIRVYDRRMDPRDSMLRLWRSGSGR
QRTCINNVHMQRGGYRELVSGATNGLVELWDIRYQDPVESFRDENMQQQGAQKRMTTMTT
TQVHEHAPIVATGTKQIKIWTTSGDLLNSFKNYHNTGGVAGTLAATGIRSTVPSSSFLSA
MVFHPHRMMLAATNSHDSSINIYKCEDRRSDLYY
NT seq 4605 nt NT seq  +upstreamnt  +downstreamnt
atgccagtggtttatggtcctcagcctttgaggccattaaatttggagactaggcatggt
ttcgacgaacagtatagtagtgagcagtatttgcaatcactggcaaacgactttatattt
tactttgatgataagaggcatagaaccaatggaaatcctactcctgaggaagaaaagacc
caggatgtcaataactattaccagccgatctatgattggaaaattatgaaagagcgacaa
aaaactgtgagtgcagcattgttattgtgtttgaacttgggtgtagatccaccagacgtg
ataaagacgcatccatgtgccaggacagaagcatgggtagatcctctgaacttccaggat
tctaagaaagccattgagcaaataggaaagaatttacagtcacagtatgagactttgtca
ctgaggacaagatacaagcagagtttggacccatgcgtggaagatgtcaagagattttgt
aactcactaaggcgtacgtccaaggatgatagaattttgtttcattacaatggacacgga
gtaccacagccgacgccatctggggaaatctgggttttcaatagaggatatacgcagtac
attccagtgtcgctgtatgatttacaaacttggttaggtgcaccgtgcatatatgtctac
gattgtaacagcgcaggcaacattgtcacaaatttccaaaagtttgttcagaagagaata
cgagatgaggaagagggaataccaaatgcagcagcgccctctcgagcatcggcatatgca
gagtgcttccagttggcatcttgtagagcaaacgaattgttacttacgagtcctgagctg
ccggctgatttgttcacatgctgtctaacgtgtcccatcgaaatcagtgtgagagttttc
ttaatgcaatcgcctctgaaagactctaaatacagcattttcttcaagagcccatctggt
gacaacacgaacgaatcacagaattctttcaaagcgaatgtacctagcgttaatataccc
ggtgttctttcagacaggagaacgcctcttggcgaacttaattggatctttactgcaatt
acagataccattgcatggacttcgttgcctagacctcttttcaagaaactctttagacat
gatttgatggttgctgctctgtttcgtaactttttactggccaagaggcttatgccctgg
tacaattgtcatccagtatcagatcctgaattgcctgacagtattgcagatcatccaatg
tggaagtcttgggacttggcgctagatgaagtgctcaataagctagtgaacgatttgaaa
aatgcccctccttccgctgatttggagactaagatgatcttgcaacagcaggagtcttta
caaacccagcaatcgcagcagcagcagcaaccacaagagatgaaatctgggagtattcaa
gaaaagtccagatttgcagtagcgaacttaagcaccatgtctttggctaatcatcccgca
gctttagcggcgtccaaaaaatcttcaggtaacgtggcgcaagctgcgcagcagcagcaa
cagcaacctcaacaacaacagtttacgggattcttcgagcagaatctcaccgcctttgag
ctatggcttaagtacgcctccaacacaagacatccaccggagcaattgccaatagttcta
caggtgctactttcccaagttcatcgtatacgtgccctagttctactgtcgaggtttctc
gatctgggcccgtgggcagtatatctttcattatccattggtattttcccctatgttctc
aaactattacaaagtcctgctccagaattgaaaccaatattagtctttatctgggcaaga
attatgtccatcgactataaaaatacgcaggcagaactaatgaaggaaaagggctacatg
tacttcgtgtccgttttggtacctgattggggcttaaacatgtcaccaacaactggtggt
tctttgagtgccggttctccactaaccatgactgcttcgccaagcattcatgcacctaga
ggccaacactatcagcagcaaatggcgaatggctttagggcttcaagtccagcattgcat
tatccttctagtgatactacggacgaacaaaaggcaatgtctgtcttcgtgttgtcatca
tttgtgcgggacttccctctagggcaaaagaactgctttagtttggagctggtcaacaag
ctatgtttctacatcgataattcagacattccacttctcaggcagtggtgcataattctc
ataggacaattgtgccagcagaacccattaaatcgttacatctgcatgaccgctggaatt
atagacactttggtaagatctttgaaagatccagtcccagaggttagaacagcggttttg
ttggctctgaagcattttatatctgacattgacgatggagataatattctcaaactgcag
caagatttggagcagcattatcaacaactgcatacacaatttcagcagcttcagagctct
gctcatcaacagcagacccagcagattgaacatcagcaactcaaagtcgagcaacaactt
caacattgtcaggtaatgcagatgcagatacagaacatcgagtcaaggaaattgaagagg
caagaaatttccaaccttgtgtcagtgttggctctcattaacgatggttcgccgcttgtg
aggaaggaagttataatatttttctcgcaagtagtgtatcgctacattaatttctttgtt
gttgtagccttcaatgagcttactgaggagatgattcaaatggaaggaacagatgcggaa
gcgcagagttacacagataagcattctatcagccatgggtccgtttttaccacggtctgg
gaggcgttacttattttggcagaagatccttttagtgaaaataggctgcttgcgggacat
gttgtcgaatacatcttaagtgaattgagtgtacataaggaactaagtgaagctttttcg
aagatggagcaatacctaacaaaaagtggtaacaatgcgcacaatgggaagacgggcttc
agcgcagctcaggtgcaagttttaaaacccacaggtccattttccattgaacattcaagg
cagaaggaaacacaaaaacaagagcaaaatatttctcattcgaaaggtaacttagggaga
atctttcgtgctcttggattcaaagatttggcaacggaggagcgtgaaacagctcatttg
aggaatagccgtaagacaaagagctcaggcatctcactcttgagccagccacatggcgct
gccccacttgcgaaaacagtttgtgctggcagaaacaagtctactcttaaattgcctctg
gagagcacctttctagattactctcgtgaatactttcaagagccgcagatgagaaagcag
gaggcagatgagtttggtagcgttgaatatagctccaggctgtggcgtaggaatcgcaac
gaaatggtgatccaggaaactcaggcacaaaagagtttgtctttgtatggtgactggtct
aatcgatgggctacacttgacaataaaacacatccaaaagttatatcattttcgcagttc
gagaattacctagtatctgctgacgagagagatattattacggtctttgactgggaagaa
aaggaaaccttggcaaaattctcgaatggaaatcctttcggcactaaggtcacagatctg
aagtttctgaacgaggatgatgctgcactattactggcggcctcatctgagggcattgtc
aaggtgtacaaaaacattaatgcttcggaagatcttgagatgataacgtcttggaggggg
ttgacggatatgctgctgacacccaaatctagtggtctgctaacggaatggcagcaaata
agaggttccttacttgccactggtgacgtgaaaataattaggatatgggatgctcataca
gagacaattgaagttgacattcctgccaaaacatcatccctcgtaacatcgatcacttct
gatcaattggctgggaacgtctttgtcgcgggtttcgcagaaggttctataagggtttac
gaccgtcgtatggaccccagagattccatgcttcgtctctggaggtcagggagtggtaga
cagcggacttgtatcaacaacgtgcatatgcagagaggtggctatagagagcttgtgagt
ggtgctacaaatgggctcgtggagttatgggacatcaggtatcaagatccagtcgaatcc
ttcagagacgagaacatgcagcaacaaggtgctcaaaaaagaatgacaacgatgacaact
actcaagttcatgagcacgcccccatcgtagccacaggtacaaagcaaatcaagatttgg
actacttctggtgatctgttgaacagcttcaaaaactatcataatactgggggcgttgcg
gggacgctggctgccactggtatacgttcaacagtaccatctagcagcttcttatctgcg
atggtctttcacccccatcgaatgatgcttgctgctacaaattctcatgactcaagtatc
aacatttacaagtgtgaagatagaagatctgatttatactattaa

DBGET integrated database retrieval system