KEGG   Torulaspora delbrueckii: TDEL_0G00730Help
Entry
TDEL_0G00730      CDS       T02236                                 

Gene name
TDEL0G00730
Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
tdl  Torulaspora delbrueckii
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:147888..152492
Genome map
AA seq 1534 aa AA seqDB search
MPVVYGPQPLRPLNLETRHGFDEQYSSEQYLQSLANDFIFYFDDKRHRTNGNPTPEEEKT
QDVNNYYQPIYDWKIMKERQKTVSAALLLCLNLGVDPPDVIKTHPCARTEAWVDPLNFQD
SKKAIEQIGKNLQSQYETLSLRTRYKQSLDPCVEDVKRFCNSLRRTSKDDRILFHYNGHG
VPQPTPSGEIWVFNRGYTQYIPVSLYDLQTWLGAPCIYVYDCNSAGNIVTNFQKFVQKRI
RDEEEGIPNAAAPSRASAYAECFQLASCRANELLLTSPELPADLFTCCLTCPIEISVRVF
LMQSPLKDSKYSIFFKSPSGDNTNESQNSFKANVPSVNIPGVLSDRRTPLGELNWIFTAI
TDTIAWTSLPRPLFKKLFRHDLMVAALFRNFLLAKRLMPWYNCHPVSDPELPDSIADHPM
WKSWDLALDEVLNKLVNDLKNAPPSADLETKMILQQQESLQTQQSQQQQQPQEMKSGSIQ
EKSRFAVANLSTMSLANHPAALAASKKSSGNVAQAAQQQQQQPQQQQFTGFFEQNLTAFE
LWLKYASNTRHPPEQLPIVLQVLLSQVHRIRALVLLSRFLDLGPWAVYLSLSIGIFPYVL
KLLQSPAPELKPILVFIWARIMSIDYKNTQAELMKEKGYMYFVSVLVPDWGLNMSPTTGG
SLSAGSPLTMTASPSIHAPRGQHYQQQMANGFRASSPALHYPSSDTTDEQKAMSVFVLSS
FVRDFPLGQKNCFSLELVNKLCFYIDNSDIPLLRQWCIILIGQLCQQNPLNRYICMTAGI
IDTLVRSLKDPVPEVRTAVLLALKHFISDIDDGDNILKLQQDLEQHYQQLHTQFQQLQSS
AHQQQTQQIEHQQLKVEQQLQHCQVMQMQIQNIESRKLKRQEISNLVSVLALINDGSPLV
RKEVIIFFSQVVYRYINFFVVVAFNELTEEMIQMEGTDAEAQSYTDKHSISHGSVFTTVW
EALLILAEDPFSENRLLAGHVVEYILSELSVHKELSEAFSKMEQYLTKSGNNAHNGKTGF
SAAQVQVLKPTGPFSIEHSRQKETQKQEQNISHSKGNLGRIFRALGFKDLATEERETAHL
RNSRKTKSSGISLLSQPHGAAPLAKTVCAGRNKSTLKLPLESTFLDYSREYFQEPQMRKQ
EADEFGSVEYSSRLWRRNRNEMVIQETQAQKSLSLYGDWSNRWATLDNKTHPKVISFSQF
ENYLVSADERDIITVFDWEEKETLAKFSNGNPFGTKVTDLKFLNEDDAALLLAASSEGIV
KVYKNINASEDLEMITSWRGLTDMLLTPKSSGLLTEWQQIRGSLLATGDVKIIRIWDAHT
ETIEVDIPAKTSSLVTSITSDQLAGNVFVAGFAEGSIRVYDRRMDPRDSMLRLWRSGSGR
QRTCINNVHMQRGGYRELVSGATNGLVELWDIRYQDPVESFRDENMQQQGAQKRMTTMTT
TQVHEHAPIVATGTKQIKIWTTSGDLLNSFKNYHNTGGVAGTLAATGIRSTVPSSSFLSA
MVFHPHRMMLAATNSHDSSINIYKCEDRRSDLYY
NT seq 4605 nt NT seq  +upstreamnt  +downstreamnt
atgccagtggtttatggtcctcagcctttgaggccattaaatttggagactaggcatggt
ttcgacgaacagtatagtagtgagcagtatttgcaatcactggcaaacgactttatattt
tactttgatgataagaggcatagaaccaatggaaatcctactcctgaggaagaaaagacc
caggatgtcaataactattaccagccgatctatgattggaaaattatgaaagagcgacaa
aaaactgtgagtgcagcattgttattgtgtttgaacttgggtgtagatccaccagacgtg
ataaagacgcatccatgtgccaggacagaagcatgggtagatcctctgaacttccaggat
tctaagaaagccattgagcaaataggaaagaatttacagtcacagtatgagactttgtca
ctgaggacaagatacaagcagagtttggacccatgcgtggaagatgtcaagagattttgt
aactcactaaggcgtacgtccaaggatgatagaattttgtttcattacaatggacacgga
gtaccacagccgacgccatctggggaaatctgggttttcaatagaggatatacgcagtac
attccagtgtcgctgtatgatttacaaacttggttaggtgcaccgtgcatatatgtctac
gattgtaacagcgcaggcaacattgtcacaaatttccaaaagtttgttcagaagagaata
cgagatgaggaagagggaataccaaatgcagcagcgccctctcgagcatcggcatatgca
gagtgcttccagttggcatcttgtagagcaaacgaattgttacttacgagtcctgagctg
ccggctgatttgttcacatgctgtctaacgtgtcccatcgaaatcagtgtgagagttttc
ttaatgcaatcgcctctgaaagactctaaatacagcattttcttcaagagcccatctggt
gacaacacgaacgaatcacagaattctttcaaagcgaatgtacctagcgttaatataccc
ggtgttctttcagacaggagaacgcctcttggcgaacttaattggatctttactgcaatt
acagataccattgcatggacttcgttgcctagacctcttttcaagaaactctttagacat
gatttgatggttgctgctctgtttcgtaactttttactggccaagaggcttatgccctgg
tacaattgtcatccagtatcagatcctgaattgcctgacagtattgcagatcatccaatg
tggaagtcttgggacttggcgctagatgaagtgctcaataagctagtgaacgatttgaaa
aatgcccctccttccgctgatttggagactaagatgatcttgcaacagcaggagtcttta
caaacccagcaatcgcagcagcagcagcaaccacaagagatgaaatctgggagtattcaa
gaaaagtccagatttgcagtagcgaacttaagcaccatgtctttggctaatcatcccgca
gctttagcggcgtccaaaaaatcttcaggtaacgtggcgcaagctgcgcagcagcagcaa
cagcaacctcaacaacaacagtttacgggattcttcgagcagaatctcaccgcctttgag
ctatggcttaagtacgcctccaacacaagacatccaccggagcaattgccaatagttcta
caggtgctactttcccaagttcatcgtatacgtgccctagttctactgtcgaggtttctc
gatctgggcccgtgggcagtatatctttcattatccattggtattttcccctatgttctc
aaactattacaaagtcctgctccagaattgaaaccaatattagtctttatctgggcaaga
attatgtccatcgactataaaaatacgcaggcagaactaatgaaggaaaagggctacatg
tacttcgtgtccgttttggtacctgattggggcttaaacatgtcaccaacaactggtggt
tctttgagtgccggttctccactaaccatgactgcttcgccaagcattcatgcacctaga
ggccaacactatcagcagcaaatggcgaatggctttagggcttcaagtccagcattgcat
tatccttctagtgatactacggacgaacaaaaggcaatgtctgtcttcgtgttgtcatca
tttgtgcgggacttccctctagggcaaaagaactgctttagtttggagctggtcaacaag
ctatgtttctacatcgataattcagacattccacttctcaggcagtggtgcataattctc
ataggacaattgtgccagcagaacccattaaatcgttacatctgcatgaccgctggaatt
atagacactttggtaagatctttgaaagatccagtcccagaggttagaacagcggttttg
ttggctctgaagcattttatatctgacattgacgatggagataatattctcaaactgcag
caagatttggagcagcattatcaacaactgcatacacaatttcagcagcttcagagctct
gctcatcaacagcagacccagcagattgaacatcagcaactcaaagtcgagcaacaactt
caacattgtcaggtaatgcagatgcagatacagaacatcgagtcaaggaaattgaagagg
caagaaatttccaaccttgtgtcagtgttggctctcattaacgatggttcgccgcttgtg
aggaaggaagttataatatttttctcgcaagtagtgtatcgctacattaatttctttgtt
gttgtagccttcaatgagcttactgaggagatgattcaaatggaaggaacagatgcggaa
gcgcagagttacacagataagcattctatcagccatgggtccgtttttaccacggtctgg
gaggcgttacttattttggcagaagatccttttagtgaaaataggctgcttgcgggacat
gttgtcgaatacatcttaagtgaattgagtgtacataaggaactaagtgaagctttttcg
aagatggagcaatacctaacaaaaagtggtaacaatgcgcacaatgggaagacgggcttc
agcgcagctcaggtgcaagttttaaaacccacaggtccattttccattgaacattcaagg
cagaaggaaacacaaaaacaagagcaaaatatttctcattcgaaaggtaacttagggaga
atctttcgtgctcttggattcaaagatttggcaacggaggagcgtgaaacagctcatttg
aggaatagccgtaagacaaagagctcaggcatctcactcttgagccagccacatggcgct
gccccacttgcgaaaacagtttgtgctggcagaaacaagtctactcttaaattgcctctg
gagagcacctttctagattactctcgtgaatactttcaagagccgcagatgagaaagcag
gaggcagatgagtttggtagcgttgaatatagctccaggctgtggcgtaggaatcgcaac
gaaatggtgatccaggaaactcaggcacaaaagagtttgtctttgtatggtgactggtct
aatcgatgggctacacttgacaataaaacacatccaaaagttatatcattttcgcagttc
gagaattacctagtatctgctgacgagagagatattattacggtctttgactgggaagaa
aaggaaaccttggcaaaattctcgaatggaaatcctttcggcactaaggtcacagatctg
aagtttctgaacgaggatgatgctgcactattactggcggcctcatctgagggcattgtc
aaggtgtacaaaaacattaatgcttcggaagatcttgagatgataacgtcttggaggggg
ttgacggatatgctgctgacacccaaatctagtggtctgctaacggaatggcagcaaata
agaggttccttacttgccactggtgacgtgaaaataattaggatatgggatgctcataca
gagacaattgaagttgacattcctgccaaaacatcatccctcgtaacatcgatcacttct
gatcaattggctgggaacgtctttgtcgcgggtttcgcagaaggttctataagggtttac
gaccgtcgtatggaccccagagattccatgcttcgtctctggaggtcagggagtggtaga
cagcggacttgtatcaacaacgtgcatatgcagagaggtggctatagagagcttgtgagt
ggtgctacaaatgggctcgtggagttatgggacatcaggtatcaagatccagtcgaatcc
ttcagagacgagaacatgcagcaacaaggtgctcaaaaaagaatgacaacgatgacaact
actcaagttcatgagcacgcccccatcgtagccacaggtacaaagcaaatcaagatttgg
actacttctggtgatctgttgaacagcttcaaaaactatcataatactgggggcgttgcg
gggacgctggctgccactggtatacgttcaacagtaccatctagcagcttcttatctgcg
atggtctttcacccccatcgaatgatgcttgctgctacaaattctcatgactcaagtatc
aacatttacaagtgtgaagatagaagatctgatttatactattaa

DBGET integrated database retrieval system