KEGG   Torulaspora delbrueckii: TDEL_0G00890Help
Entry
TDEL_0G00890      CDS       T02236                                 

Gene name
TDEL0G00890
Definition
(RefSeq) hypothetical protein
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     TDEL_0G00890 (TDEL0G00890)
Transcription machinery [BR:tdl03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     TDEL_0G00890 (TDEL0G00890)
Chromosome [BR:tdl03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    TDEL_0G00890 (TDEL0G00890)
   HAT complexes
    PCAF complex
     TDEL_0G00890 (TDEL0G00890)
    STAGA complex
     TDEL_0G00890 (TDEL0G00890)
    TFTC complex
     TDEL_0G00890 (TDEL0G00890)
    SAGA complex
     TDEL_0G00890 (TDEL0G00890)
    SLIK complex
     TDEL_0G00890 (TDEL0G00890)
    ADA-HAT complex
     TDEL_0G00890 (TDEL0G00890)
    HAT-A2 complex
     TDEL_0G00890 (TDEL0G00890)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(180736..182220)
Genome map
AA seq 494 aa AA seqDB search
MVAKRRKARTRHEEKVEEPELKKQKATQGKEEVKPNIEEQEPQETSIDDKEDLKEQELES
SNAEQSAEKTLAKDESNEIKKDQEETPKEEAAQEKPADEVKENHIEELKQEPEVTAVTHE
VIEDENNGITKFEFDGVEYKFKERASVIEEREGRIEFRVVNNDNTKENLMVLTGLKNIFQ
KQLPKMPKEYIARLVYDRSHLSMAVVRKPLTVVGGITYRPFEKREFGEIVFCAISSTEQV
RGYGAHLMNHLKDYVRNTTSIKHFLTYADNYAIGYFKKQGFTKEITLEKSIWMGYIKDYE
GGTLMQCTMLPRIRYLDAAKILLLQEAALRRKIRTISKSHIIRPGLKVFKDVKNIKPVDP
MTIPGLKEAGWTPEMDELAQRPKRGPHYASMQNILTELQNHAAAWPFLQPVNREEVPDYY
DFIKEPMDLSTMEVKLENNRYEKMENFIYDARLIFNNCRMYNGENTSYFKYANRLEKFFN
SKIKEIPEYSHLVD
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaagcgcaggaaggctagaactcgccatgaggaaaaggtcgaagagcccgag
ttgaaaaagcagaaggctacacagggtaaagaagaggtaaagccgaatatagaagaacag
gagcctcaggagacctctattgatgataaagaagatttaaaagagcaagaattggaatca
tcaaacgcggaacagagtgcggagaagacattagcgaaagatgagtccaacgagattaaa
aaagaccaagaagaaactccaaaagaggaagcagcacaggaaaaacccgctgatgaagtc
aaagagaatcatattgaagagcttaaacaagagcctgaagtaacagcagtgacacatgaa
gttattgaggacgaaaacaatggcattacaaagtttgagtttgatggagttgaatacaag
ttcaaagaaagggccagtgtcatcgaagagagagagggaagaatcgagtttcgagtagtg
aataatgacaatacgaaggagaatctgatggttttgaccggtctcaagaacatatttcag
aaacaattgcccaagatgccgaaggaatacattgctagattggtctacgaccgcagtcat
ttgtccatggctgtggttagaaaaccgttgaccgtggtcggtgggattacgtatcgcccg
tttgagaaacgagaatttggagaaattgtgttctgtgccattagttccaccgagcaggta
agagggtatggtgcacatttgatgaatcatttgaaagattacgtgcgaaatacaaccagt
atcaaacacttcttaacatacgccgataactatgccattggatactttaagaaacagggt
tttacaaaagagataactttggagaaaagcatatggatgggttacatcaaggattatgaa
ggtggtactttaatgcaatgtactatgctgccgcgaatacgatacctggatgcggctaag
attctgcttttacaagaagctgcattaaggcggaagataagaaccatttccaaatcgcat
ataatcaggcctggtttgaaagtcttcaaggatgttaaaaatattaaacctgtggatcca
atgaccattccgggactgaaagaagcaggttggactcctgaaatggatgagctagcacaa
aggcccaagcgaggaccacactatgcctcgatgcaaaacattctcactgagctacagaac
cacgcagccgcatggccttttcttcaacctgttaatcgagaagaagttccagattattac
gattttatcaaagaaccgatggatctaagtactatggaggttaagttggagaataacagg
tatgaaaagatggaaaatttcatttatgacgcaagattgatctttaacaattgtagaatg
tacaatggtgaaaacacatcgtacttcaaatacgccaacaggttggaaaaattcttcaat
agtaagatcaaagaaataccagaatactcacatcttgtggattga

DBGET integrated database retrieval system