KEGG   Torulaspora delbrueckii: TDEL_0G01090Help
Entry
TDEL_0G01090      CDS       T02236                                 

Gene name
TDEL0G01090
Definition
hypothetical protein
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    TDEL_0G01090 (TDEL0G01090)
   01230 Biosynthesis of amino acids
    TDEL_0G01090 (TDEL0G01090)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    TDEL_0G01090 (TDEL0G01090)
   00030 Pentose phosphate pathway
    TDEL_0G01090 (TDEL0G01090)
   00051 Fructose and mannose metabolism
    TDEL_0G01090 (TDEL0G01090)
   00052 Galactose metabolism
    TDEL_0G01090 (TDEL0G01090)
  Energy metabolism
   00680 Methane metabolism
    TDEL_0G01090 (TDEL0G01090)
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    TDEL_0G01090 (TDEL0G01090)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     TDEL_0G01090 (TDEL0G01090)
Protein phosphatases and associated proteins [BR:tdl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     TDEL_0G01090 (TDEL0G01090)
Messenger RNA biogenesis [BR:tdl03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     TDEL_0G01090 (TDEL0G01090)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:223036..225987
Genome map
AA seq 983 aa AA seqDB search
MVALQEACYGVAFASVTTNDENKFRDCIQFYHSLGFATVKDFNKFKHGENLILSSGTSQD
SLKEAWLEAFKLSEMDESGFRIPQQEAKNKHQSGGALIKIRLVMHEPIKDTNKDACIVTY
FTTELGKVIERFPNAEKVSDDLVLIKDPLGNKIGFSPLASPLDEEPTARDFFLDDSATEA
GSTVQSANAEILRQTLSGQKKKKIAVMTSGGDSPGMNAAVRAVVRTGIHFGCDVFAVYEG
YEGLLKGGNYLRKMEWEDVRGWLSEGGTLIGTARCMEFKERWGRKQAAGNLISQGIDALI
VCGGDGSLTGADLFRHEWPSLVEELVKDGKFTKEQVEPYKNLTMVGLVGSIDNDMAGTDS
TIGAYSALERICEMVDYIDETAKSHSRAFVVEVMGRHCGWLALMAGIATGADYIFIPERA
VPHGKWQDELKEVCQRHRNKGRRNNTVIVAEGALDDLLNPVTTEDVKNVLVDLGLDTKVT
ILGHVQRGGTAVAHDRWLATLQGVDSVKAVLEMTPSTPSPLIGILENKIIRKPLVESVEA
TKSVATAIANKDFDAAISKRDTEFIELYENFLSTTVKDDGAELLPEDQRLNIGIVHVGAP
SAALNAATRAATLYCISHGHKPFAILNGFSGLIQTGQMKELSWIDVENWHNLGGSEIGTN
RSVAADDMGTVAYYFQKAKLDGLIIIGGFEGFNSLKQLRDSRSEYPIFNIPMVLIPSTIS
NNVPGTEYSLGVDTCLNALVRYTDEIKQSASATRRRVFVVEVQGGHSGFIASFTGLITGA
VSVYTPEDKITLSTIREDLALLKENFRHDKGENRNGKLVIRNEQASSVYSTELLANIISE
SSKDRFGVRTAIPGHVQQGGFPSSKDRVVASRFAVKCVKFIEQWNKKNNIQQDKGAGDEK
VLRFKFDIHGNKVSTVEHEDDSAAVICVNGTNVSFKPIADLWEHETNVALRKGEEIHWSE
FSRIGDILSGRLKLRAEVEAASK
NT seq 2952 nt NT seq  +upstreamnt  +downstreamnt
atggtggctcttcaagaagcatgctacggtgtagcatttgcatcagtgactacaaatgat
gaaaacaaattcagggactgtattcaattttaccactctctaggtttcgctaccgtcaag
gattttaataaattcaaacatggtgaaaatttgattctatcttctggtacttctcaagat
tctttgaaggaagcatggttggaagcattcaaattgagtgaaatggatgaaagtggattt
cgtatcccacaacaagaggctaagaacaagcaccaaagtggtggtgctttgattaagatt
cgtcttgtcatgcatgaaccaattaaagatacaaataaggacgcttgtatagtgacttat
ttcaccactgagttgggcaaggtgattgaaagatttccaaatgctgaaaaagtttccgat
gatttggtccttatcaaggacccattgggcaacaagattggtttctctccattggcttct
ccattggacgaggaaccaactgctagggacttcttcctagatgatagcgcaacagaagca
ggttccacagttcagagtgccaatgcagagatcttgagacaaactttgagcggtcagaag
aagaagaagattgctgttatgacttctggtggtgattctccaggtatgaacgctgctgtg
cgtgctgtggttcgtactggtattcactttggttgtgatgtgttcgctgtttacgaaggt
tacgaaggtctgttgaaaggtggtaactatttgagaaagatggaatgggaagatgtcaga
ggttggttgagtgaaggtggtactttgatcggtactgctcgttgtatggagttcaaagaa
cgttggggtcgtaaacaggctgctggtaacttgatctctcaaggtattgatgctttgatc
gtttgtggtggtgatggttcactaacaggtgctgatttgttcagacacgaatggccatcc
ttggttgaagaattggtgaaggatggtaagttcactaaagaacaagttgaaccatacaaa
aacttgaccatggtcggtcttgttggttctatcgataacgatatggcaggtactgattct
accattggtgcttactctgctttggagagaatttgtgaaatggttgattacattgatgaa
actgccaaatctcactctcgtgctttcgttgttgaagttatgggtagacactgtggttgg
ttagctttgatggccggtattgctactggtgctgactacatctttatcccagagagagct
gttcctcacggtaaatggcaagatgagttgaaggaagtttgtcaaagacacagaaacaag
ggtagaagaaacaacactgtgattgttgctgaaggtgctttggatgatctattgaaccct
gtcactactgaggatgtcaagaacgtcttggttgatttgggtctagataccaaggtcacc
atcttgggtcacgttcaaagaggtggtacagctgtcgctcacgacagatggttagctact
ttgcaaggtgttgactccgtcaaggccgttcttgaaatgactccaagcactccatcccca
ttgattggtatcttggaaaacaagatcatcagaaagcctttggtcgagtctgttgaagca
actaaatctgtggctactgccattgctaacaaggatttcgatgctgcaatctctaagaga
gacaccgaattcattgaactatatgagaacttcttgtctactacagtcaaggatgatggt
gctgaattgttgccagaagaccaaagattgaacattggtattgttcacgttggtgctcca
tctgctgctttgaacgccgctactcgtgcagctactttgtactgtatctctcatggtcac
aagccttttgctatcttgaatggtttcagtggtttgattcaaaccggtcaaatgaaggaa
ttgtcctggattgatgttgagaactggcacaacctgggtggttctgaaatcggtactaac
agatctgtggctgctgatgatatgggtaccgttgcatactatttccaaaaagccaaattg
gatggtttgattatcatcggtggtttcgaaggtttcaactctttgaaacaactacgtgat
agcagaagcgaatacccaatcttcaacatcccaatggtgttgatcccatccactatctct
aacaatgtcccaggtactgaatactctcttggtgtcgacacctgtttgaacgccttggtc
aggtacacagacgaaattaagcaaagtgcttccgccacaagaagaagagtcttcgtcgtg
gaagttcaaggtggtcactctggtttcattgcctccttcactggtctaatcactggtgca
gtctcggtatacactccagaggacaagatcactttgtctactatcagagaagacttggct
ttgctaaaggagaacttccgtcacgacaagggtgagaaccgtaacggtaagcttgtgatc
agaaatgaacaagcttctagcgtttacagcacagaattgttggccaacattatttctgaa
tcgagcaaggacagatttggtgttagaaccgctattccaggccacgtccaacaaggtgga
ttcccaagctctaaggaccgtgttgtcgcttctagattcgctgtcaagtgtgttaagttc
attgaacaatggaacaagaagaacaacatccaacaggacaagggcgctggtgatgaaaaa
gtgctaagattcaagttcgacatacacggtaacaaggtctctaccgttgagcatgaagat
gattctgctgctgttatctgtgtcaacggtactaacgtttctttcaagccaattgctgac
ttgtgggaacacgagactaacgttgcactaagaaagggtgaagaaattcactggtcagag
tttagcagaatcggtgacatcttatccggtagattaaagctaagagccgaagtggaagcc
gcatccaaataa

DBGET integrated database retrieval system