KEGG   Torulaspora delbrueckii: TDEL_0G01820Help
Entry
TDEL_0G01820      CDS       T02236                                 

Gene name
TDEL0G01820
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    TDEL_0G01820 (TDEL0G01820)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     TDEL_0G01820 (TDEL0G01820)
Exosome [BR:tdl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   TDEL_0G01820 (TDEL0G01820)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:364972..367068
Genome map
AA seq 698 aa AA seqDB search
MFRCYIRSLRGLAIRRPVWKRSIYTVKSEYTLPEMTADENPKLTVDEVIPLIAAIDVGTT
SSRAILFNRLGQEVAKHQIEYSTSASKEKYAASGKRRRFSVDESNQPIFSAEGIAIEENE
FLEIEDLIIKAGHPTLRFPKPGWVECNPLNILDNVVECFAKTLAFTYHVNAQRIPDGLPP
YQVHCIGIASMRETTLVWSKKTGMPIVDYGIVWNDTRNAAIVTEKRNSTPEDEQTRLRNK
TGLPLYSTYFSCSKLRWLLDNEPKVKEAYGSGDLMFGTVDSWLIYHLTKSHAFVSDVTNA
SRTGFMNLDTLDYDDELLDYWGIDKNKINLPRIVSSAEYYGDFHVPQVTKDHIPLADWKI
LSDFSHRTPRIPLQGCLGDQSASLVGQLAFKPGSAKCTYGTGCFLLYNTGSTKLISQHGA
LTTFGYWFPHLADEEARKPHFALEGSVAVAGAVVQWLRDNLRLIPKAEDIGPLASRVPDS
GGVVFVPAFSGLFAPYWDPEARATIMGMSQFTTASHIARAAVEGVCFQARAILKAMSSDA
LGTKDRDFLEEVSAGTYEKSLLSTLAVDGGMSRSDEVMQIQANILGPCVKVRRSPTHECT
ALGAAIAAEMAFKDPKDRLMWKDLKDVKKYIFYNGVEKDEECPLELQPDLKIFTSTSNNT
ERRKKWRIWEEAVKRSRGWLSSLESMEDEDDEKGTDGK
NT seq 2097 nt NT seq  +upstreamnt  +downstreamnt
atgtttcgatgctatataagaagcctacgtggtctagcaataagacgacctgtgtggaag
agaagtatctatacggttaagagcgaatatacgttgcccgagatgactgctgatgaaaac
ccaaagttgaccgtggatgaagttatcccactgatcgcggcgatcgacgttggaactacg
tcttcgcgggcgattttgtttaatagactgggccaggaagttgcgaagcaccagatcgag
tactctacttctgcttcgaaggagaaatatgctgcgtctggtaaaaggcgtagattcagt
gttgatgaaagtaaccaacctatcttctctgcagaaggtattgcgatcgaggagaatgag
tttttagagattgaggatttgattattaaagctggacatccgactttaaggtttccaaaa
cctggttgggttgaatgcaacccgcttaatattttggacaatgtggttgaatgttttgcc
aagactttagcttttacgtaccatgtgaatgcgcagcggattcctgatggacttccaccc
tatcaggtacattgtattggtatagccagtatgcgtgagacgactttggtgtggtccaaa
aagactgggatgcccattgtggattatgggattgtgtggaacgatactagaaatgcagca
attgttacagagaagaggaacagcacacctgaggatgagcaaacgaggttgagaaacaag
acggggttgcctttgtactctacgtatttttcgtgctcaaagttgcgttggttgctggac
aatgagccaaaagtgaaggaggcctacgggtcgggcgacttgatgtttggtaccgtcgac
agctggctgatctaccacttgaccaaatcgcatgcttttgtgtctgatgttacgaatgct
tcccgtacggggttcatgaacttggatactcttgattacgatgacgaattgcttgattat
tgggggatcgataagaacaagatcaatttgccccgcattgtatcgtctgccgagtactat
ggtgatttccacgtaccgcaagtgacaaaggaccatatcccgctcgctgactggaagatt
ctgtcggatttcagtcacagaaccccaagaatccccttgcagggttgtcttggtgaccaa
agcgcttcgctagtgggtcaattggctttcaagcccggttctgccaagtgtacttacggt
accgggtgtttcttgctttacaatactggctcaacaaagctgatatcccaacacggtgct
ttgacaacttttggttactggtttccacacttggccgatgaagaggcaaggaaaccacat
tttgcactggaaggttctgtggcagtcgctggtgcagtggtgcaatggctaagagataac
ttacgattgatccccaaggctgaagatataggtcccttagcaagcagagtacctgattct
ggaggggtagtgtttgtccctgccttcagtggtttatttgcaccctactgggacccagaa
gcccgtgctaccatcatgggtatgtcgcaattcaccactgcttcacacatcgccagagcc
gctgttgaaggtgtatgtttccaagctcgtgctatcttaaaagctatgagttccgacgct
ttgggaaccaaggacagagatttccttgaagaagttagcgctggtacttatgagaaatca
ctcctatccactttggccgttgatggtggtatgtcccgttcggatgaagttatgcaaatt
caagccaatatcctaggaccttgtgtcaaagtgagaagatctcccacgcacgaatgtaca
gcgctcggggcagccattgctgctgaaatggctttcaaagaccccaaggaccgtctcatg
tggaaggatttgaaagatgtcaagaagtacattttctacaacggtgtcgaaaaagatgaa
gagtgtccgcttgagctacaaccagatctcaagatctttactagtacgtcgaataatact
gaacgtaggaagaaatggcgaatctgggaagaagccgtcaagagatcccgaggttggctc
tcttcattggaatcaatggaggacgaagacgatgagaaagggactgacggtaaataa

DBGET integrated database retrieval system