KEGG   Torulaspora delbrueckii: TDEL_0G02370Help
Entry
TDEL_0G02370      CDS       T02236                                 

Gene name
TDEL0G02370
Definition
hypothetical protein
Orthology
K11870  
ubiquitin carboxyl-terminal hydrolase 1 [EC:3.1.2.15]
Organism
tdl  Torulaspora delbrueckii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:456393..458636
Genome map
AA seq 747 aa AA seqDB search
MSFILETLQRKIISFIIEPLNRNTNSEVPITTAIILVSTAFFFIKYKSFIMNNLSHIGDM
TRNFNPTNGFRRWMPRGGQVDQHTLDKGGYVAGLVNDGNTCFMNSVIQSLASSAELMKFL
DDEIAKKEEIDETELLQDEEKPTSVEPDTIERKVKGKSYGKAKKHANRKLANGVSDEEKT
PDVTFSLALREMLNKLNTKYYKERPCFKTNKLLKSMTKSPNKNIILGYDQEDAQEFFQTI
LSELEKNVKSLEGKPSEATPIPNAELPKNAVIGQAHLDKVGDVYLPSDQIDPNLVLTNEG
KQLYTPFRLVTPLDGITAERIGCLQCGENGGIRYSVTSSMSLNLPSEDIGSTLKLSDLLN
QWIKPEIIEGVSCNRCALEAVRDHLLEQLKQYENKGDSIPEKLLQAFKARVEELNVSLSK
PMVSDEDYKRLHTENMTRKCSKSKQILFLRPPPLLSIHINRSVFDPRTYMIRKNNSRVLF
KSRLNLSPWCCDVDEINLDARLPMSKKQEQVQESSEDENLGGEYYAKLHQTYEKEFEDSD
EEVEQDGDRYVNRDVSEYDPLNGEIDSVSSYSDNEDAHHSSEEFLEEVDALGNTVTKKVA
KLQSHFGDEDGVEVEIKENGAEELSSSESEGEQEDGIMPPPVNTAPIPSTVPAGPLTYVL
RSVIVHYGTHNYGHYIAFRKYRGCWWRISDETVYVVEEAEVLSTSGVFMLFYEYDYDEAT
GKMREDLESDLEDENQEEDEKLDGEIE
NT seq 2244 nt NT seq  +upstreamnt  +downstreamnt
atgagttttatattggaaacgctacaacggaaaatcatttcatttattatagaaccgctc
aataggaataccaactctgaagtaccgatcactactgctatcattctcgtatccaccgca
ttttttttcattaagtataagagctttattatgaataacttgtcacatattggagatatg
accaggaactttaacccaacaaatgggttccgtcgttggatgcctagaggtggacaggta
gatcagcatacactcgataaaggcgggtatgttgccggtctcgtcaacgatggcaacacc
tgctttatgaactctgtgattcagtcgctagcatcgtctgcagagttgatgaagtttcta
gacgatgagattgctaaaaaagaggaaatagatgaaactgagcttttacaggatgaagag
aaacccacttcggtcgaaccagacacaatagagaggaaggtcaagggcaaatcgtatggc
aaggccaagaaacatgctaatcgtaagctggcaaacggagtatccgatgaggaaaaaaca
cccgatgtgacttttagtctagccctaagagagatgctcaacaaactgaataccaaatat
tacaaggaaaggccgtgtttcaagactaacaagctactgaaatcaatgacaaaatctcca
aataagaacataatcttggggtacgaccaagaagatgcccaagaattcttccagactata
ttatccgaactcgagaaaaatgtcaagtctctggagggaaagccatcggaggctacccca
atccctaacgctgaactaccaaaaaacgctgttataggtcaggcgcatctcgataaagtt
ggggatgtatacttgccttcggaccaaatcgatccaaatcttgtgttgactaacgagggg
aaacaactttacacacccttcagattggtcacacctttagacggtattactgcagagaga
ataggctgcttacaatgtggtgagaatggtgggataaggtactccgtcacatcaagtatg
agtttaaatttaccatcggaagacattggatcgactctcaagctttctgatcttttaaac
caatggataaagcccgagatcattgaaggagtctcatgtaatcgttgtgccttggaagca
gtacgtgatcatttgctggaacaactaaaacagtatgaaaacaagggcgattcaatccct
gagaaattgctccaggcattcaaggccagggttgaagagttaaacgtaagtctatcgaag
ccgatggtaagtgatgaggattacaagaggttacatacggagaatatgacgcgcaaatgt
tccaagtcaaagcaaatcctgttcttgaggcctccgccattactgtcaattcatatcaac
cgatctgtattcgatcccaggacatacatgatcagaaagaacaattcaagagtactcttc
aaatctagattgaacctatcaccatggtgttgcgatgtcgatgagatcaatttagatgcg
cgattaccgatgtcaaagaaacaagaacaagtacaggaatctagtgaagatgagaacctt
ggcggcgaatactatgccaaattgcatcagacttatgagaaggaatttgaggatagcgac
gaggaagtcgagcaagacggtgaccgttatgtcaacagagatgtaagtgaatacgaccca
ctaaatggtgaaatagacagcgtctcgtcgtactcggacaatgaagatgctcaccacagt
agcgaggaatttttagaagaggttgatgctttggggaatactgttaccaagaaggttgcc
aaactacagagccatttcggtgatgaagacggagtagaagtggaaattaaagaaaatgga
gcagaggaactatcttcttcagaaagcgaaggcgagcaagaggatgggattatgccccct
ccagtgaacactgcaccaataccatcgacagtgccggcgggacctctaacttacgttcta
cgttctgttattgtgcattacggtactcacaactatggccattacattgcatttagaaaa
tataggggctgctggtggagaatctctgacgagacagtttatgtggtcgaagaagctgaa
gtgttatcaacctctggggtctttatgttattttatgagtatgactacgatgaagccaca
ggtaagatgcgagaagacctagaaagcgatcttgaggatgaaaaccaagaagaagacgag
aaactggatggtgagatagaatga

DBGET integrated database retrieval system