KEGG   Torulaspora delbrueckii: TDEL_0G02920Help
Entry
TDEL_0G02920      CDS       T02236                                 

Gene name
TDEL0G02920
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
tdl  Torulaspora delbrueckii
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    TDEL_0G02920 (TDEL0G02920)
Enzymes [BR:tdl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose---protein mannosyltransferase
     TDEL_0G02920 (TDEL0G02920)
Glycosyltransferases [BR:tdl01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   TDEL_0G02920 (TDEL0G02920)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:556753..559245
Genome map
AA seq 830 aa AA seqDB search
MSVKDEKRTSGVENDPMQPLEVKQGPVRPFVVSEPPKTLAAARSTRSLKERLVVIGLAIF
TVAIRLHDLSWPNQVIFDEVHFGGFASEYIKKDFFFDVHPPLAKMIFAWIASLAGFTGDF
EFKNIGDIYPSTTPYVLMRSWAATCGCLTVILLYFTLRASGVRMWVALASAVCFAVENSF
VTISRYILLDAPLMLFIAGAVYAFKKYEVFPTDTYQSLKYLVLTGVFLGFAASAKWVGFF
TIAWVGLLCAFRLWFFIGDLTKPIRSTVKVAVIKGTVLLGVPLIIYTMIFYIHFQTLTHD
TAGSGFYSSEFRSTLEGNHIPSDILAEVGVGSTVTLHHLNTRGGYLHSHLHEYPAGSKQQ
QITLYPHLDGNNEWLISLYNQTDAPLTSFENLPDGTKIRLLHKVTSRRLHSHDHKPPVSE
NSDWQKEVSGYGFEGFDGDANDDWIIEIDKDLSKPGPARDHVRALETKFRLKHAITGCYL
FSHEVKLPKWGFDQQEVTCAHSGKPELLLWYIEGNTNDLLPEDAERISYKPSSFLKKFLE
TNERMWTINKNLVDTHVYESMPSSWPFLLRGIGYWTGEHRHVYLLGNAVLWWSVSSFIAL
FAMIIMFELGSWQVGKPILQDSDVVNFHIQVSEYLLGFAVHIAPSFLMKRQLFLHHYLPA
YYFGILAFGQALEAFVSYIFRRAKTIGYAFILVFVASSIFFFKFYSPLTYGTAWTKDLCE
KSQLLSGWDYTCDSYLNTYEDYKNLNSTSVVAETAETIVNEPAVTSYANIEEVKESEELV
EVDDFESLMNEPGEKKFLDQNGNPLSPEEVQKLVEEQGGRIQKVQERSHD
NT seq 2493 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtaaaagacgaaaaacggacttctggtgtggaaaatgatcccatgcaaccgttg
gaagtgaaacagggtcccgtgagaccgttcgtggtctctgaacctcccaagactctggcg
gcagctcgttcaactcgttctcttaaagagagactcgtggttattggtttggcgattttt
actgtcgccattagacttcacgatctgtcatggcccaatcaagtgatcttcgatgaggtg
cattttggtggctttgcttctgaatacatcaaaaaagatttcttctttgatgtgcatcca
cctcttgcaaagatgatctttgcctggattgcctctttggccgggtttactggtgatttt
gaatttaagaatattggtgatatttacccttcgactactccttatgtgctgatgagatcg
tgggctgcaacatgtggctgtttgaccgttatccttttgtattttacgttgcgtgcctct
ggtgtgcgtatgtgggttgcattggctagtgctgtatgttttgcagttgagaactcattt
gtgactatctcacgttatatcctactggatgcaccattgatgttatttattgcgggcgct
gtttatgcgtttaagaaatacgaagtattcccaactgatacttaccagtctttgaagtat
ttggtgctcactggtgtttttctcggttttgctgcatctgccaaatgggttggtttcttc
actattgcctgggttggtctactgtgtgcatttagactatggttctttatcggtgacttg
actaagccaatccgatccactgtgaaagtcgctgtcatcaagggaactgtcttattaggt
gttccattgatcatatacacgatgatcttttacattcatttccagactttgactcatgac
acagcaggctcaggtttctactcttcagaattcagaagtactctagaaggtaaccacatc
ccatcggatattttggctgaagtcggtgttggctccactgtgactttgcatcatctaaac
actagaggtggatatcttcactcccatcttcacgaatacccagccggttcaaagcaacag
cagataaccttataccctcacttagatggtaacaatgaatggttgatttctttgtacaat
caaaccgatgcacctttaacatctttcgaaaatttaccagatgggacaaagatcagatta
ctacataaagtaacaagccgcagattgcattcacacgaccataagccacctgtctctgag
aacagtgattggcagaaggaagtttctggttacggttttgagggttttgatggtgatgct
aacgatgattggatcattgaaattgacaaggatttatctaagccaggcccagcaagagat
catgtcagagctctggagaccaagtttagactaaagcacgccatcactggttgttacttg
ttttctcacgaagtgaagttaccaaaatggggttttgatcaacaagaggttacctgcgct
cattccggtaagccagagctattgctatggtacattgaaggcaataccaatgatttgttg
ccagaagatgctgagcgtatctcttacaagccgtcatctttcttgaagaagttcctagag
acaaatgaaagaatgtggaccattaacaaaaacttggtcgacacacacgtctacgaatct
atgccctccagctggccattcttgttacgtgggattggctactggactggtgaacacaga
cacgtctatttgttgggtaacgcagttttatggtggtccgtttcttccttcattgctctc
tttgcaatgatcataatgtttgaattgggctcatggcaagtcggcaaacctattttacag
gattccgatgttgttaacttccatattcaagtttctgagtacttgctaggatttgctgtt
catatcgcaccatccttcttgatgaagcgtcaactgtttttgcaccactacttgcctgct
tattatttcggtattttggcatttggacaagcattggaagcattcgtgagttacattttt
agaagagcgaaaacaattggatacgctttcattctcgtctttgttgcgtcttcgatcttc
ttcttcaaattttacagtcctttgacttacggtactgcctggactaaagacctatgtgag
aaatcgcaattgttatccggttgggattacacctgtgactcttatttgaacacttacgag
gattataagaacttgaattctacatcagtagtggctgagaccgctgaaaccattgttaat
gagccagccgtcacctcatatgctaacattgaggaggtaaaggaaagcgaagagctggtt
gaagtggacgatttcgaatcattaatgaacgagccaggtgagaagaaatttttggaccag
aatggcaaccctctaagtcctgaagaagtacaaaaacttgtagaggaacaaggcggtagg
attcaaaaagttcaagaaagatcgcatgattaa

DBGET integrated database retrieval system