KEGG   Torulaspora delbrueckii: TDEL_0G03650Help
Entry
TDEL_0G03650      CDS       T02236                                 

Gene name
TDEL0G03650
Definition
hypothetical protein
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    TDEL_0G03650 (TDEL0G03650)
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    TDEL_0G03650 (TDEL0G03650)
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     TDEL_0G03650 (TDEL0G03650)
Lipid biosynthesis proteins [BR:tdl01004]
 Desaturase
  First
   TDEL_0G03650 (TDEL0G03650)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:673347..674798
Genome map
AA seq 483 aa AA seqDB search
MSKMDEVDLVQANVLASGANKKSVRIVNGLGSLMGSKSMVDVDFKSDSNMDYLLRRDEEE
KARYAKNRHISEQPWTLNNWHKHLNWLNMILVVFLPSIGWYMALSGKAPLQLNTLLFSLF
YYAVGGASITAGYHRLWSHRSYSARWPLRLLYAFFGSASVEGSVKWWGHSHRIHHRYTDT
VRDPYDARRGLWFSHMGWMLLKPNPKYRARADIEDLADDWIVRFQHRHYIPLMLLSAFVL
PTIVCGYFFNDYLGGFVYAGLIRVFCIQQATFCINSLAHYLGDQPFDDRRTPRDNWITAL
VTFGEGYHNFHHEFPTDYRNAIRWYQYDPTKVIIYLSSMCGLAYDLKKFSHNAIQQALVQ
QQQKKLDRQRSKLNWGPQLTDLPVWDKQDFLKEMETRKGLVVISGIVHDVSGYITEHPGG
ETLLQAALGKDATKAFNGGVYRHSNAAHNVLATMRVAVVKDGEDAAIKFAARRGETYAKS
KAE
NT seq 1452 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaatggatgaagtggatctggttcaggccaacgttttggcctcaggtgctaat
aagaaatctgtgcgtattgtcaatggtcttggatctttgatgggatccaagagtatggtc
gatgtggatttcaaaagtgattccaatatggactacctattgagacgtgacgaagaggag
aaggctaggtatgcaaagaatagacatatttctgaacagccttggactttgaacaactgg
cacaaacatttgaattggttgaatatgatccttgtggtctttttaccttctatcgggtgg
tatatggctctttctggtaaggcacctttgcaactgaacactttgttgttctcattgttc
tactatgcggtcggtggggcttctattacagctggttaccatcgtctgtggtctcacaga
tcttactctgcgcgctggccgctacgtttattgtatgcattctttggatctgctagtgtg
gaaggttccgtcaaatggtggggtcattctcacagaatccaccatcgttacaccgacact
gtcagagatccttatgatgctcgtagaggtctgtggttttctcacatgggttggatgctt
ttgaagccaaatccaaaatatagagctcgtgcggacattgaagacttggccgatgactgg
atcgttaggttccaacacagacactatatcccattgatgcttctatctgctttcgttttg
ccaactattgtttgtggttacttcttcaacgattacttgggtggtttcgtgtatgctggt
ttgatccgtgtgttctgtatccaacaggctactttctgtatcaactcgttggctcactac
ttgggtgatcaaccttttgatgacagaagaaccccacgtgacaactggatcactgctttg
gttacctttggtgaaggttaccacaatttccaccacgagttcccaaccgattacagaaac
gctatccgttggtatcaatatgatcctacaaaggttatcatttacttgagttcgatgtgt
ggtcttgcttacgatttgaaaaaattctctcataacgctatccaacaggcattggtgcaa
caacagcagaagaaactagatagacagagatccaagttgaactggggtccacaattgacc
gacttgcccgtctgggacaagcaggatttcctaaaggaaatggaaacaagaaagggtcta
gtggtgatctccggtattgtacacgatgtctctggctacatcactgaacatccaggtggt
gaaactttgttgcaagcagcccttgggaaggatgctacaaaggctttcaacggtggtgtt
taccgtcattctaatgccgctcacaacgtcttggctactatgagagtcgccgttgtcaag
gatggtgaagatgccgctattaagttcgccgcaagaagaggtgaaacttatgctaaatct
aaggcagaataa

DBGET integrated database retrieval system