KEGG   Torulaspora delbrueckii: TDEL_0G04220Help
Entry
TDEL_0G04220      CDS       T02236                                 

Gene name
TDEL0G04220
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
tdl  Torulaspora delbrueckii
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    TDEL_0G04220 (TDEL0G04220)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.91  sphinganine kinase
     TDEL_0G04220 (TDEL0G04220)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:complement(765502..767400)
Genome map
AA seq 632 aa AA seqDB search
MNLPPTSPANLQTLKDKDFNEATLTDDGIMITSQGHPDSYKASANVNADPVTGDHNESMT
SVRSNNSFFETASLISCVTCLSDNYDQGNRLNPSGENTEGAAKNTGEDDVPYSSVTGQLL
VNTVIPYSRILHARYLENPKGYTDDLETANASSDLIEIDDTATGSGSDPFSKDSIEHHKP
KYSKTKGRLNRPALVEITFAKPRRHDIVPKHLTLSISYPSLSRGADIVEEILKRSYKNAK
RERSILVIVNPFGGKGKAKKMFMSKCKPILLASNCSIDTAYTKYAMHAVDIAREIDLDKY
DTIACASGDGIPYEVINGLYQRPDRAEAFTKLAITQLPCGSGNAMSVSCHWTSNPSYAAL
CLVKSVEARIDLMCCSQPSYYQNFPRLSFLSQTYGVIAESDINTEFIRWMGPARFELGVA
FNVLQRKKYPCDIYVKYAAKSKNDLKVHYMEHKNRASLRFENDVDDILNDNLSGDCFQDP
SWSQVKESDFKLKYPLEDGVPSDWERISPDITDNLGIFYTGKMPYIAADTKFFPAALPAD
GTMDLVVTDARTPVTRMAPILLALDKGSHVLQPEVIHSKISAYKLVPKITNSLFSVDGEK
FPLEPLQVEIMPHLCKTLLRNGCYVDTEFDSM
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaccgccaacttctcctgctaatttgcaaactttgaaagataaggattttaat
gaagcaacactcaccgatgatggtattatgatcacttctcagggtcatcctgactcctat
aaagcttccgcgaatgtaaatgcagatccagtaacgggcgatcacaatgagagtatgact
agtgttcgaagtaacaatagtttctttgaaaccgcttctttaattagctgtgttacgtgt
ttgagtgacaactacgaccagggaaatcgtttgaatccaagtggtgaaaacacagaaggt
gcagccaagaatacgggtgaagatgatgttccatactcttccgtgacaggtcaattactt
gtaaacactgttatcccatacagtagaatcttacatgcaagatatttagaaaatccaaag
ggatatacagatgatcttgagacagccaatgcttcatcggatttgattgaaattgatgac
accgccactggtagtggtagtgatcctttctctaaagattccattgaacatcacaagccc
aagtattctaaaacgaaagggcgccttaatcggcccgctttggttgaaattacgtttgca
aaacctaggcgtcatgatattgtaccgaagcatctaactttgtcaataagttatccaagc
ctgtctcgtggtgctgatattgttgaggaaattctaaaaagaagttacaaaaatgccaaa
agagagagatcaatccttgttattgttaatccatttggtggtaaaggtaaggctaagaaa
atgttcatgagtaaatgtaagccaattctcctggcaagtaactgttcaatcgatactgcc
tataccaaatatgcaatgcacgccgtagacattgctcgtgaaattgatctagacaaatat
gacaccatcgcgtgtgcttcaggtgatggtataccatatgaagtgataaacgggctatat
caaagaccagatcgggctgaagccttcacaaaattggccattacgcaacttccttgtggt
tcaggtaacgcaatgagtgtgtcgtgccattggaccagtaacccttcatatgctgcatta
tgtctagtgaaatccgtggaggctagaattgatttaatgtgttgttctcagccgtcttac
taccagaatttcccacgtttatcttttctcagtcaaacttatggtgtcattgccgaatct
gatatcaataccgagtttatcagatggatgggacctgcaagattcgaactgggcgttgca
tttaacgtcctacagcggaaaaaatacccctgtgatatctatgtgaaatacgctgcgaag
tcaaagaacgatttgaaagttcattatatggagcataagaaccgagcttctctaagattc
gagaatgatgtggatgatattttgaatgataatctatcgggggactgcttccaggatcca
agttggtcgcaagtgaaagagagcgacttcaagttgaaataccctttagaagatggtgta
ccgtcagattgggaaagaattagtccagatataacagacaatttggggatattctacacc
gggaagatgccgtacattgcggcagatacgaagttcttccctgctgctttacctgctgat
ggtaccatggatcttgtggtaactgacgctcggactcctgtaacaagaatggcaccaatt
cttttggcgctggacaaaggttcacacgttttacagcctgaagttatacactcaaaaatc
tcggcctataagctggtacccaagataacaaatagtttgttttcagttgacggtgagaaa
tttcccttggagccattacaagtggaaataatgccacacctctgtaagacgttgctgaga
aatggatgttatgtggatactgagtttgattcgatgtag

DBGET integrated database retrieval system