KEGG   Torulaspora delbrueckii: TDEL_0G04270Help
Entry
TDEL_0G04270      CDS       T02236                                 

Gene name
TDEL0G04270
Definition
hypothetical protein
Orthology
K13333  
lysophospholipase [EC:3.1.1.5]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    TDEL_0G04270 (TDEL0G04270)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     TDEL_0G04270 (TDEL0G04270)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:775229..777178
Genome map
AA seq 649 aa AA seqDB search
MNLKEWLLFSIAVFFAQGTLAWSPSNSYTPANVSCDEDINLIRQASGPSDDETEWLKKRD
VYTREALRSFLDRATSNFSDSSLVSQLFSNASDIPRIAVACSGGGYRAMLSGAGMLAAMD
NRTDGANEHGLGGLLQSTTYLAGLSGGNWLVGTLAWNNWTSVQDIVNNMTADDSIWDISN
SIINPGGFMIVTTIKRWDHISDAVEGKQDAGFNVSLTDIWGRALSYNFFPSLYSGDVAYT
WSTLRDVEVFQNGEMPFPISVADGRYPGTQIIDLNATVFEFNPFEMGSWDPTLNAFTDVK
YLGTKVSNGEPVNKGQCVAGYDNTGFIMGTSSSLFNQFLLQINSTSLPSFIKNLVTGFLD
DLSEDEDDIAIYAPNPFKDTSYIHDNFSKSISESDYLYLVDGGEDNQNIPLVPLVQDERN
IDVIFALDNSADTDYYWPDGASLVSTYERQFSSQGMNMSFPYVPDKRTFVNLGLADKPSF
FGCDAQNLTDLNYIPPLVVYIPNARHSYNSNTSTFKLSYTDDERLKMIKNGFEAATRGNL
TDDSSFMGCVACAVMRRKQQSLNATLPEECNTCFTNYCWNGTIDDTPVSGLDNSDFDPTA
ASSAYSAYNTESYSSSSATGSKKNGAGLPASPTSFTSVLTLLTAIAGFL
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgaatcttaaagagtggctattgttctcgatagcagtattctttgctcaaggcactctt
gcctggtctccttccaatagttatactcccgcaaacgttagttgcgacgaggatatcaat
ttgattagacaggcttcaggaccttctgatgatgaaactgaatggttaaagaaaagagac
gtatacactagagaagcacttagatcattcttagatcgtgctactagtaatttttcagat
agttcattagtctctcaattgttctccaatgcttcagatattcctagaattgctgttgcg
tgttccggtggtgggtaccgtgctatgttaagtggtgcaggtatgctggccgcgatggat
aatagaacggatggtgccaatgaacatggtctgggtggtcttttgcaaagtactacatat
ttggcagggttaagtggtggtaattggttagttggaactttggcatggaataattggacc
tctgtgcaggatattgtcaataatatgaccgcggatgactctatttgggatatttccaat
tcgattattaatcctggtgggttcatgatcgttactacgatcaagagatgggatcacatc
tctgatgcagtcgagggtaaacaggatgcagggttcaatgtcagtttgaccgatatttgg
ggtcgtgcgctttcttataacttcttcccaagtttgtacagtggtgatgtcgcctataca
tggtctactttgagggatgtcgaggtgttccaaaacggtgaaatgccattcccaatctcg
gttgctgacggtagataccctggtacccaaattatcgatttgaacgctactgtcttcgaa
ttcaacccatttgagatgggttcttgggatcctactttgaacgctttcaccgatgtcaag
tatctcggaacaaaggtctccaacggtgaacctgttaacaagggccaatgcgttgctggt
tacgataatacgggattcatcatgggtacttcatcttctttattcaatcaatttttgtta
cagatcaattcgacctcattaccaagtttcatcaaaaacttggtcactggtttcctggat
gacctgtccgaggatgaagacgatatcgccatctatgcaccaaatcctttcaaggacaca
tcgtacattcacgacaatttctcaaaatcgatctctgaatcggactatctgtatttggtc
gatggtggtgaggataatcaaaatattccattggtgcctttagtccaggatgaacgtaat
atcgatgttatctttgccctcgataattctgcagacactgactactattggcccgatggt
gcgtctttggtctctacttatgagcgtcagttcagttctcaaggtatgaacatgtcattc
ccatatgtccctgacaaaagaacttttgttaacttaggtttggctgacaagccaagtttc
ttcggttgtgatgcccaaaatttaactgacctgaactacattccacctttggtggtctat
atccctaacgcaaggcattcctacaacagtaacaccagtactttcaagctttcttacact
gatgacgaacgtttgaagatgatcaagaatgggttcgaggctgccacaagaggcaacttg
actgacgattcctcgtttatgggttgtgtcgcctgtgcagtgatgagacgtaagcagcag
agtttgaatgccactttgccagaagaatgtaatacttgtttcaccaattactgctggaat
ggtaccattgatgacactccagtctctgggctagataatagtgattttgaccctacagca
gcatcttctgcctacagcgcttacaacacagaaagctacagttcttcatcggctacggga
tctaagaaaaacggtgccggccttcctgccagtccaacgtccttcacctctgtactcact
ctgctcacagccatcgcaggcttcctatga

DBGET integrated database retrieval system