KEGG   Torulaspora delbrueckii: TDEL_0G04680Help
Entry
TDEL_0G04680      CDS       T02236                                 

Gene name
TDEL0G04680
Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
tdl  Torulaspora delbrueckii
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    TDEL_0G04680 (TDEL0G04680)
 Environmental Information Processing
  Signal transduction
   04070 Phosphatidylinositol signaling system
    TDEL_0G04680 (TDEL0G04680)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     TDEL_0G04680 (TDEL0G04680)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:854988..857567
Genome map
AA seq 859 aa AA seqDB search
MVSFRRSPSRGSVDDIAINKRDVADHKVSIPPSAFPLSSSSSANMSKNIKAMFKRSGLSN
SSKESIILGHAGPMTYPYSFKEVIGYYISKEAVFQGLNSSCSALTEGLCMKRISRRKQVP
YIFRLHENEAITWKDGTKRLELDSIKDIRTGDMASNYREEYGVSDKVAGLWVTIIYTVSN
KLKALHVVARHGSDFSIFFNCICGLVKSRRELMESISVPDNEKFANIHWHRTVSERKEDE
IKDTLRFEDVRRLCDKFHIYCSSSHLLRFFKIADVNHNGLLNFHEFQTFVKLLKERPEVH
HLWKSCTLGKNYMDFGMFYNFIRDVQKEDLTKENACELFENFRRPKQKHLDEEDFVRFLG
AQPYAKEIEEDYSKPLNHYFIASSHNTYLLGKQVGERPSVEGYVQVLQQGCRCIEIDIWD
DDIGPVVCHGFLTTAIPLINVVEIIKKYAFITSPYPLIISLEMNCGKENQLIATSIFQNC
FGSLLYYPDDKDNFLPSPMKLRHKIVLKGKKTNRKSLAGTTGNLNSIESSSSSYSSSYDS
EIESGNKGKENLYNTSNNSKIRRIKRLTLKRRVEVIDDLLNICGLHGLKFRNLSLPESKT
VAHCFSFNEKSFYNMQKDKTQELSLDKHNRRFLTRVYPHALRYKSSNFNPINFWKLGVQM
VATNWQTNDLGQQINLAMFQLSSQKSGVAHSGYILKPAKLLPTVSKVQQIPQLYQKLRKN
PSKIELKILSAQLLPKPAEIKDGKESSFAPYVVAELFSDEEPAASSTVDNGLKLSNMSAA
TENCKDNGFNPVWGMNMSATLKSLDFAFVRFTVKTGEISLATSCLRLQYLKPGYRHIPLY
SMEGELYIFSTLFIFTRSI
NT seq 2580 nt NT seq  +upstreamnt  +downstreamnt
atggtttctttcagaagaagcccatcaagaggatcagttgatgacattgcaataaacaaa
cgcgatgtggcggaccacaaggtcagtatacctcctagtgccttccctctttcgagctct
agtagtgccaatatgagtaagaatatcaaagccatgtttaaaagatcggggttgtccaat
tcttcaaaggaatcgataatccttggtcatgcagggcccatgacatatccatattccttt
aaagaagtcatcggttattatatttccaaagaagcggtatttcaaggcctaaatagttca
tgctcagctttgacagagggactttgcatgaagaggatcagtagaagaaaacaagtacca
tacatctttagactacatgaaaatgaagctatcacatggaaggatggtaccaaaagatta
gagctggactctattaaagatatacgtacgggcgatatggcgagcaattaccgagaggag
tatggagtttctgataaggtggccgggctttgggttaccattatatatacagtatcgaac
aagttgaaggccttgcatgtggtggcaaggcatggaagtgatttttcgatattctttaac
tgtatctgtggactagtgaaatcaagaagagaactcatggagagtatttctgttccggat
aatgaaaagttcgctaatatccattggcatagaacggtttctgagagaaaggaagatgag
atcaaagatacattgagattcgaggacgtaaggcgactttgtgacaaattccacatttat
tgttcatcaagtcacttacttaggttctttaaaatcgccgatgtcaatcacaatggactt
ttgaactttcatgagtttcagacgtttgttaagctactgaaggagcgtcccgaggtacat
cacctttggaaatcatgcactctggggaaaaattatatggactttgggatgttttacaac
ttcatcagagatgtacagaaggaggatttgaccaaggaaaatgcgtgcgagctattcgaa
aattttaggcgccctaagcaaaagcatttggatgaggaggattttgttagattcttggga
gctcagccttatgcaaaggagatagaggaggattatagcaaaccattaaatcattatttc
atagcatcctcgcacaatacctatctattagggaaacaagtaggtgaaaggccatccgtt
gaaggttatgtgcaggtacttcaacaagggtgtcgatgcattgaaatcgacatttgggat
gatgatattggtcccgtagtatgtcacggtttcttaacaactgcgattcctctgataaat
gtcgttgaaataattaaaaaatacgcgtttatcacatcaccatacccccttatcatctca
ttggaaatgaattgtggcaaggagaaccagttgattgcaacgtcaatttttcagaattgt
tttggatcgctgctatactacccagatgataaggacaacttcttgccgtccccaatgaag
cttaggcacaagatagtactcaagggtaaaaagacaaatcgaaagtcactggctggtacc
acagggaacctgaacagcattgaaagcagctcttcatcatacagctcttcatatgattct
gaaatagagagtgggaacaagggaaaagaaaacctgtacaatacctcgaacaactccaag
attcgtaggattaaaagattaacattgaaaaggcgtgttgaggtgatcgatgatctcttg
aacatatgtgggcttcacggattgaaattcagaaacctttcgctgccagaatccaagact
gtcgcccattgtttttcctttaatgagaaaagtttttataacatgcagaaggacaagacc
caagagctttcgctagacaagcataatcgccggttccttacgcgtgtctatcctcacgct
ctaaggtataaatcttctaatttcaatccgatcaatttttggaaacttggggtccaaatg
gtagcgacaaattggcaaaccaacgacctcggccagcagatcaaccttgcgatgttccaa
ctgtcgagtcaaaaaagtggtgttgcgcactcaggatacatattgaaaccggccaaattg
ctcccgactgtgtctaaagttcaacagattccgcaattgtaccaaaagttgagaaagaat
cccagcaagatcgaattgaagattctctccgcacaactcctccccaaaccagctgagata
aaggacggcaaggagtcctcctttgccccctacgttgttgcagaactattcagtgacgaa
gagcctgctgcttcttcgacagtcgacaacggactcaagctttccaacatgtcggctgcg
accgaaaactgcaaagacaacgggttcaatccggtatggggcatgaatatgtcggcaaca
ctcaaatcactagatttcgcattcgtcagattcacagtcaaaactggagagatttctttg
gcgacttcgtgcttacgactacaatacttgaagccgggataccggcacatcccgctctac
agcatggagggcgagctctacattttctctactcttttcatatttacaagatcgatttag

DBGET integrated database retrieval system