KEGG   Torulaspora delbrueckii: TDEL_0G04880Help
Entry
TDEL_0G04880      CDS       T02236                                 

Gene name
TDEL0G04880
Definition
hypothetical protein
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
tdl  Torulaspora delbrueckii
Pathway
Arginine and proline metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    TDEL_0G04880 (TDEL0G04880)
Enzymes [BR:tdl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     TDEL_0G04880 (TDEL0G04880)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
7:901871..903211
Genome map
AA seq 446 aa AA seqDB search
MKITKSCLLLSSAAYIQAASIPEQMFLSCERSDGNPNHQASPHTKTTGNKSFLDAYFGNF
LDGVADAVTVKGKREPLPLPDEIRGLAVHDNYEYPDPDDLRDINGSAVLYRGGEFGYIDT
FAHLPLTNCFDPELYEKESFDIAVIGAPFDSGVSYRPGARFGPSGIRLGSRRLAPAYSVY
NEKLNPYKNWAKIVDCGSPPVTPLDNRIAIDQIYRANRAAGKHSVTKKNKFDHPKIVTLG
GDHTITLPAIKAAFENWGKISVIHFDSHLDTWNPYYFGGNVTDYQSLNHGTYLHWAHEKG
LLSDTSIHAAIRGPYPGKKDVEHDISCGFDRILARDIDKIGADGIIKKIKQRVGDSPVYI
TVDVDSMDPSTAPASGTVEPGGWTSRELLTVLDGLDGINIIGGDVVEVSPPYDTAAEITS
VVAAQVADSIISLMVLQGESDTTDSE
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcactaagagctgcctcttactatcgtcagcagcttacatccaagctgcttca
atcccggagcagatgtttctcagctgtgaacgcagcgatggaaatcccaatcatcaagct
tctcctcacaccaaaacaactggcaacaagtcatttttggatgcctactttggcaatttc
ttggatggcgttgcggatgctgtgactgtcaagggtaaacgtgaaccacttcctctccca
gatgaaattcgcggtcttgctgtccatgacaactacgagtatccagaccctgacgatctg
agagatatcaatggctcagcggttctttaccgtggtggtgaatttgggtacattgatacc
ttcgctcatcttcccttgaccaattgttttgatcctgaattgtacgaaaaggaatccttt
gatatcgcggtgattggtgctccatttgattctggagtttcctatagaccaggtgctaga
ttcgggccatcaggtattagacttggttccagaagattggctcccgcttactctgtctat
aacgagaagctaaacccttacaaaaactgggcaaaaattgttgattgtggctcaccacca
gtgactccgctcgacaacagaatcgccatcgaccaaatctatcgtgccaacagagctgca
ggaaaacactctgttacgaaaaaaaacaagtttgatcatcctaagattgtcactcttgga
ggtgaccataccatcacccttccagcaattaaagctgcttttgagaactgggggaaaatc
tcagtcattcattttgactctcacttggatacctggaatccttattactttggtgggaac
gtcacggactatcaatcgttgaatcacggtacgtatttgcactgggctcatgaaaagggt
ctattatctgatacgtctattcatgctgccattagaggcccctaccctggtaaaaaagat
gttgaacacgacattagttgtggatttgacagaattttggccagggacattgacaagatt
ggtgcagacggaattatcaaaaaaatcaaacaaagagttggggacagccctgtgtacatc
actgttgatgtcgactctatggatccttcgacggctcctgctagtggtactgtcgagcca
ggtggatggacttccagagaactactaaccgttctagatggattagacggtattaacatc
ataggaggagatgttgttgaggtttctccaccctacgataccgcagccgagattacctca
gtcgttgctgcccaagtggccgattccattatttccctgatggttttacaaggagagtcc
gacacaactgacagcgagtaa

DBGET integrated database retrieval system