KEGG   Torulaspora delbrueckii: TDEL_0H00300Help
Entry
TDEL_0H00300      CDS       T02236                                 

Gene name
TDEL0H00300
Definition
hypothetical protein
Orthology
K01196  
glycogen debranching enzyme [EC:2.4.1.25 3.2.1.33]
Organism
tdl  Torulaspora delbrueckii
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    TDEL_0H00300 (TDEL0H00300)
Enzymes [BR:tdl01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     TDEL_0H00300 (TDEL0H00300)
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.33  amylo-alpha-1,6-glucosidase
     TDEL_0H00300 (TDEL0H00300)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(42956..47536)
Genome map
AA seq 1526 aa AA seqDB search
MDRTVLLRLSDSGEPLVSCAYGKGVLTLPSLPLPKDWSLKSPLFTVRLLVGAGSPVARDG
LVWHNCPPDAGTGFDRNRFYKRRISTSFHRDDMIDLPVYSPGPYCFYLSFRNEHEVLETT
RKFYFVVPPTLQINGHSMQLDSIALQSVISKWMGSDWDKVFARIAAKGYNMIHFTPLQER
GESNSPYSIKDQLKFDPDYFQDEEQVHRMVSGLQKKYNMLSLTDIVFNHTANNSPWLLEH
PDAGYSAETAPHLTAAIELDRQLLEFSSNLKRLGYPVDLKNTDDLFKVMDGIKVHVLGSL
KLWEFYVVDVPGTVDSVKKLWDDASSEESPLEVPSDIVKDNFVQIAEFVRAHATAEEFGG
LAGRNGNQIDTKRFIKVLKNLYGESFENEILDHAHKILDEVNLPLYQSYDDDVSEILEQL
FNRIKYLRIDDHGPKQGPITDKLPLTEPYFTRFRANDGREYALANNGWIWNGNPLVDFAS
NKSRAYLRREVIVWGDCVKLRYGRGPQDSPYLWERISKYVKINAKIFDGFRIDNCHSTPL
HVAEYFLDLARSVNPNLYVVAELFSGSETMDCLFVERLGISSLIREAMQAWSVDELSRLI
HKHGGRPIGSYKFLPLDNFPFPADLETNQNFHEPRSGYISSASEILIPKILTAAPPHALF
MDCTHDNETPYQKRTVEDTLPNAALVALCSSAIGSVYGYDEIFPELLDLVQEKRVYDVKD
GNGIGEVKSKLNGIRAEISQLGSDIEDAEMHVHHAGQYITFHRTDAKTGSGWYLVARTKF
DEGGEEQPLPQLQLSQTACKFQFAYSLKKNGEVPHDEKLLKGIPTKLVEIKAVQTDFDSA
KKISIITVNEAFPQGSIAIFKTQQLGVDESLDQFIRSQALKATANVDLDSLNSILYRSEP
EEYDSSAGRNGAYDIPNYGKLVYCGLQGWVSVLHPIIFSNDLAHPLSENLRNGPWAFDYI
INRLGSYRDGAGVTDVQTWLRDRFDRIRDIPHYLAPSYFALVIGLLYGCCRFRAMQLMSA
NIGKSTLFVQSLSMTSIQMVSRMRSTSILPKENVPAMAAGLPHFSTDYMRCWGRDVFISL
RGLLLTTGRFDEAKSHILAFAKTLKHGLIPNLLDAGRNPRYNARDAAWFFFQAIQDYVDI
VPSGESILKEKVTRRFPLDDTYITFDDPKAFSYSSTLEEVMYEILVRHAKGIKYREANAG
PNLDRVMKDEGFNVEVHVDWSTGLIHGGSQFNCGTWMDKMGESEKAGSVGVPGTPRDGAA
VEINGLLKSALRFVNELNENGKFKFTKVEKEDGTEISLKEWEKLLLNNFEKKFYVPEDPA
DDCKYDIDSKIVNRRGIYKDLYRSGKPYEDYQLRPNFAIAMAVAPELFTPKLAVHAINEA
DKILRGPVGMRTLDPSDYNYRPYYNNGEDSEDFATSKGRNYHQGPEWVWLYGYFLRSFHR
FNFLTDPRAQNDAKTAPSSYLYQQLFSRMVKHTEWIAESPWAGITELTNKDGQLCNDSSP
TQAWSTGCLLDLFYDLWSKYEDSSDH
NT seq 4581 nt NT seq  +upstreamnt  +downstreamnt
atggatcgaacggtgcttctaaggttgagcgactcgggcgagccgctcgttagttgcgcg
tacggtaaaggtgtgcttactttaccttcgcttccacttccaaaagactggtcattgaag
tcgccattgtttactgtgagactattggttggggcaggttctccagtggctagagatggg
cttgtttggcacaattgtccgccagatgctggcactggctttgacagaaaccgtttttac
aagcgtaggatctctacgagcttccatcgagatgacatgatcgatttaccagtttatagt
ccgggtccatactgtttctatctatccttcagaaatgagcatgaagttctcgagactaca
cgcaagttttactttgtggtgcccccaaccttacaaataaatggtcattccatgcaatta
gactctattgccttgcaaagtgttatttccaagtggatgggttccgattgggataaggta
tttgcaagaattgctgcgaagggctataatatgattcatttcactcctttgcaagagcgt
ggagagtccaattcgccttattcaattaaagatcagctcaaattcgatccagactacttc
caggatgaggagcaagttcatagaatggtcagtgggttgcaaaagaagtacaacatgctt
tccctaacagatattgtttttaatcacacagcaaataactcaccttggctcttggaacat
ccagatgctggttacagcgccgagactgctccacatctgacagctgctatcgaactggac
cgccaattgctggagttcagcagcaatttgaagagacttggataccccgttgatttgaaa
aataccgatgatctgttcaaggttatggatggtatcaaagtgcacgtattgggctctcta
aagctgtgggaattctacgtggtggatgtgccaggcactgtagacagcgttaaaaagttg
tgggatgatgctagcagtgaagaaagtcctttagaggtccctagcgatatagtgaaagac
aatttcgtccagatcgcggagttcgtgcgcgcacatgctactgccgaagaatttggagga
cttgcaggacgtaatggtaatcaaatcgatacaaaaagatttatcaaagttttgaaaaac
ctatacggtgagtccttcgagaatgagatccttgatcatgcgcacaagatcctagacgaa
gtgaatttaccgctctatcagagttacgacgacgatgtgagcgagatcctcgagcaacta
ttcaaccgtatcaagtatctaagaattgacgaccatgggccaaaacaggggccaatcaca
gataagctgccattgacagagccatatttcaccaggtttagagcgaatgatggccgggaa
tatgcgctggcaaacaatggttggatatggaacggtaaccctttggtcgattttgcctcg
aataagtcgagagcttacttgcgtagagaagtgattgtatggggagactgtgtcaagttg
agatacggtagaggtccacaggattcaccttacctatgggaaagaatatccaagtatgtg
aaaataaatgctaaaatattcgatggcttcagaatcgataattgtcactcgacgcctttg
catgtggcagagtattttttagatctcgcaagaagcgttaatccaaatctttatgtcgtc
gcagaactgttctccggttccgaaacgatggattgcctatttgttgaaagactaggtatc
tcgtccctaatcagagaggccatgcaagcttggtctgtcgatgagcttagccgccttatc
cacaagcacggtggtaggcccattggttcttacaaatttcttccccttgataacttccca
tttcctgcggatctagagaccaatcaaaatttccatgagccacggagtggctacattagt
tcagcatccgaaatcctgatccccaagattttgacagcagctcctccacatgctctattc
atggattgtactcatgacaacgagactccttatcaaaagagaacggtcgaggatacttta
ccaaacgcagcactagtcgcgttgtgctcgagtgcgattggttctgtctatggttacgac
gaaatcttcccagaactactagatctggttcaagagaagagggtttatgatgttaaagat
ggtaatggcataggcgaggtcaaatcaaagttgaacggtattcgagcggaaattagtcaa
ttgggctctgatattgaggatgcagaaatgcacgttcaccatgctggtcaatatattact
ttccatcgtacagatgcaaaaacaggtagcggttggtatctggttgctagaacgaaattt
gatgaaggtggagaagaacaacctttacctcaactacaactgtctcagaccgcttgcaaa
ttccaatttgcgtactctttgaaaaagaatggtgaagttccccacgatgaaaagctgctc
aaaggtattccaaccaagttggtcgagataaaggctgttcagactgactttgacagcgct
aagaagatatcaatcatcactgtaaatgaagcatttccccagggttcgattgccatcttc
aaaacccagcagttaggtgttgatgagagtctggaccaatttatcaggtcccaggcatta
aaagccacagcaaacgtcgacctggattctctgaattcaattttgtatcgttcagaacca
gaggaatatgacagctctgctggtcgtaatggagcatatgatataccgaactatggcaaa
cttgtctattgtggtttgcaaggctgggtgtctgtcttacatccgatcattttctctaat
gacttagcccacccattgagcgagaatttacgtaatggaccttgggccttcgattatatc
atcaacaggctgggctcgtatagagatggagcaggtgtaactgacgttcaaacgtggttg
cgtgacagatttgacagaatcagggatattccgcattatctcgctccaagctacttcgca
ctggtgattggactactttatggttgttgccgattccgtgccatgcagttgatgtctgcc
aacatagggaaatcaacattgtttgttcagagtttgtcaatgacttctattcaaatggtg
tcgcggatgagatcgacctctatcctaccgaaggaaaacgttcctgcaatggcggctggc
ttaccgcatttcagcactgattatatgagatgttggggtagagatgtgttcatatcgttg
aggggtttgctactgacaaccggaagatttgatgaagcgaaatctcatattcttgcattt
gctaagactttgaagcatggtttgattcccaacttactcgacgcaggaagaaacccaagg
tataacgctcgtgatgctgcatggtttttcttccaagcaatccaggattatgtcgatata
gtacccagtggagagtcaattttaaaggaaaaagtcactagacgtttcccgctagacgac
acatacataactttcgatgatccaaaggcttttagctactcaagcacgcttgaagaggtg
atgtatgagatactcgtcagacacgccaaagggattaagtacagagaggctaatgcgggg
ccaaacttggatagggtcatgaaggatgaaggtttcaatgtcgaagttcatgtcgattgg
tccaccggattgattcacggaggttcgcaattcaattgcggtacttggatggataaaatg
ggtgaaagtgaaaaagcaggttctgtgggtgttcctggtaccccaagagacggcgctgcc
gttgaaatcaatgggctattgaaaagtgctctgagatttgtcaacgagcttaatgaaaat
gggaagttcaagttcactaaagttgagaaagaagatggtacagagataagtttaaaggag
tgggaaaagttactattgaacaattttgagaagaaattctacgtgccagaagatcctgct
gatgattgcaagtacgacatcgacagcaaaattgtcaaccgaagaggtatatacaaggat
ttgtaccggtccggaaaaccctatgaggattatcaactaagacccaattttgccattgcc
atggcagtagcacctgaactcttcacgccgaagctagctgtccacgccattaacgaagca
gataagatactgagaggacccgtcggtatgcgcactttggatccaagtgactacaactac
cgcccttactacaacaacggcgaggactccgaggactttgccacatctaagggaagaaat
tatcaccaaggccccgaatgggtatggctttacggctattttctcaggtcattccatcgt
ttcaatttcctcacagatccaagagcccagaacgacgcaaaaactgcaccatcgtcctac
ctataccagcaactcttctcacgaatggttaagcacactgagtggattgccgagagtccc
tgggctggtataacagagctcacgaacaaagatggccagttgtgtaacgactcgagccca
acccaagcctggagtacaggttgtctactggacctattctacgacctctggagcaagtac
gaggattcaagtgaccactaa

DBGET integrated database retrieval system