KEGG   Torulaspora delbrueckii: TDEL_0H00890Help
Entry
TDEL_0H00890      CDS       T02236                                 

Gene name
TDEL0H00890
Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
tdl  Torulaspora delbrueckii
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(146908..149088)
Genome map
AA seq 726 aa AA seqDB search
MQQGAEATGNEEANNGNQSIWNPLFMSQEENVQQLPPPQGRQQVQFNFVNPWGVANGENA
QVNQDNVPDETAYLTPSDKENVDSFARRKSSLVIPPARAPGPNPFEYDDAKAYPNMYSQR
QRPMFFPQQQQQLPQQTYNSGRFVPSGFYNPQDSQRRQSVAVVHYPTTAPNTSNASTMIP
ATGATHMNSPNRRLSAYPPSTSPTTSLQPPYKQLRRDQGTAPPQQIIIPQMQRCTSKTDL
SPMVNATPKFRRASLNSTTMSPLIALTKNLITTYSLCSPDFSYQTSKNPKRVLTKPSEAK
CNSGFDNVNSDYILYVNDVLGTEQNRRYLVLDILGQGTFGQVVKCQNVHTKEIVAVKVVK
SRAEYLNQSITEAKILELLNTKVDPMNEHHFLRLHDTFIHKNHLCLVFELLSNNLYELLK
QNQFHGLTIHLIRSFTTQLLDSLCVLKDSKLVHCDLKPENVLLCSPDKPDLKIIDFGSSC
EERRTIYTYIQSRFYRAPEVILGIPYSTSIDMWSLGCIVAELFLGIPIFPGSSEFNQLTR
IINCLGYPPTWMMDMGKNTTKFLKKTDNNDLQNIGTYKDSQKFTLKTVDEYNLEYSAQEQ
PSKQYFKWDKLPDIIKHYRLSKKIKNYSNLVEREMQDRQCLTHFLSGILNLNPLERWTPQ
QASLHPFITQQPFTGEWYPPGSFQGSTSTGAETTPAPTIKRPGNVRYPSFQEGTAREFNK
LRIVED
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgcaacaaggagccgaggccactggaaatgaagaggcaaataatggcaatcaaagtata
tggaatccattgtttatgagtcaggaagaaaacgttcaacagctgccgcctccacagggg
cggcagcaggtacaattcaatttcgttaacccttggggagtcgcgaatggagaaaatgct
caagtaaaccaggataatgtaccagatgagactgcttatttgacaccgagtgataaggag
aatgtggattcgtttgcaagacggaaatcaagcttggtgatacctccggcaagggcacca
ggtccaaatcctttcgagtatgatgatgcaaaggcgtatccgaatatgtattctcaacga
caaagaccaatgttcttcccacaacagcagcagcagttgccccaacagacgtataatagc
ggtcggtttgtaccttcaggattctataatccacaagattcacaacgaagacaaagcgtg
gcggtcgttcattaccccacaaccgcacccaatacttctaatgcttctacgatgattcct
gctactggcgcaacacatatgaactctccgaatagaagactgagtgcttatccgcctagt
actagccccacgacatcgttacaaccgccttataagcaactgagacgtgatcaaggtaca
gccccaccacagcagatcatcattcctcagatgcagagatgtacttcgaagaccgatttg
tcaccaatggtaaacgctactccaaagtttaggcgtgcttctctcaactccacaactatg
tcgcctctgatcgcattgactaagaaccttattacaacttattcgctttgctcgcccgat
ttttcttaccagacgtcgaagaacccaaagagggtgctgaccaagccaagcgaggccaag
tgtaatagtgggttcgataatgtcaatagtgactatattctttacgtgaacgacgtgctg
ggaacagaacaaaacagaagatacttggttcttgatatactaggtcaaggtacatttggc
caagtggtcaagtgtcaaaatgtccacacaaaggaaatagtcgcagttaaagtagtcaaa
tcaagagctgaatatttgaaccagagtatcacagaggcgaaaatactagaattactgaat
acgaaagtggacccgatgaacgagcaccatttcctaaggttgcatgatacgtttattcac
aagaatcatctctgcttagtctttgaactattgagcaacaatctttacgagttactaaaa
caaaaccaattccacgggttaaccatccacctaatacgatcattcactacgcaattgttg
gactctctttgtgtgctcaaggatagcaaattggttcattgtgatttaaaaccagaaaac
gttctactgtgttcaccagacaaaccagacttgaagatcatcgatttcggttcatcatgt
gaagagaggagaactatttacacctatattcaatccagattctaccgagctcccgaagtc
atcctaggtataccttactcgacaagtatcgacatgtggtctctcgggtgtatcgtggca
gaattgttccttgggattccaatttttcctggttcgtcagagttcaatcaattaacaaga
ataatcaattgcttagggtacccaccaacttggatgatggatatgggaaagaacactacg
aaattcctaaaaaaaaccgacaataacgacttacaaaacataggaacatacaaagattct
caaaaatttacattgaagacggtggatgagtacaatctggagtattccgcgcaagagcag
ccaagtaagcagtacttcaaatgggataaattaccggacattatcaaacactatagatta
tcgaagaaaatcaagaattacagtaacttggttgaacgagaaatgcaagatcgtcaatgt
ttaacccattttctcagcggtatattaaatttgaatccgctcgagaggtggaccccacaa
caggcatctttacatccattcattacacaacagcctttcacaggagagtggtacccgccg
ggttcattccaaggttcaacctcaacaggtgcagaaaccactccggctccaaccatcaaa
agaccaggcaacgttaggtacccttcattccaagagggtaccgcaagggaatttaacaag
ctacgcatagtagaggattag

DBGET integrated database retrieval system