KEGG   Torulaspora delbrueckii: TDEL_0H01050Help
Entry
TDEL_0H01050      CDS       T02236                                 

Gene name
TDEL0H01050
Definition
hypothetical protein
Orthology
K11541  
carbamoyl-phosphate synthase / aspartate carbamoyltransferase [EC:6.3.5.5 2.1.3.2]
Organism
tdl  Torulaspora delbrueckii
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Module
Uridine monophosphate biosynthesis, glutamine (+ PRPP) => UMP
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tdl00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:tdl00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(181351..188019)
Genome map
AA seq 2222 aa AA seqDB search
MSSIIPTAPVTPPMEATGDRMIALELKDGTSLLGYSFGAPKSTAGELVFQTGMVGYPESV
TDPSYEGQILVITFPLVGNYGVPDRQLIDEYVEGLPRYFESNRIHVAGLVISHYTEEYSH
WLAKSSLGRWLQEEGVPAVYGVDTRALTKHLRDKGSMLGRLALQKNNSKDIDVGSAQWKD
AFDVPEWVDPNVQNLVAKVSRKEPHLYLPPTDHEGVTLQKGPDGKTLRILAIDVGLKFNQ
IRCFVKRGVELKVVPWDYDFTQEQYDGLFISNGPGDPSVLTDLCNRLAQVIQAKKTPIFG
ICLGHQLLARASGSSTLKLKFGNRGHNIPCTSTISGRCYITSQNHGFAVDADSLTDGWKP
LFTNANDFSNEGIYHSELPYFSVQFHPESTPGPRDTEFLFDVFIQAVKEHKASGVLKPVE
FPGGKLEDNRNAHPRVEPKKVLVLGSGGLSIGQAGEFDYSGSQAIKALKEEGIYTILINP
NIATIQTSKGLADKVYFLPVTAEFVRKVILHERPDAIYVTFGGQTALSVGIEMKDEFETL
GVKVLGTPIETVITTEDRELFAQAMNQIDEKCAKSQAANSVEEALAAVKEIGFPVIVRAA
YALGGLGSGFAYNEKELVDLCNVAFASSPQVLVERSMKGWKEVEYEVVRDAFDNCITVCN
MENFDPLGIHTGDSIVVAPSQTLSDEDYNMLRTTAVNVIRHLGVVGECNIQYALNPFSKE
YCIIEVNARLSRSSALASKATGYPLAYTAAKLGLNIPLNEVTNSVTKSTCACFEPSLDYC
VVKMPRWDLKKFTRVSTALSSSMKSVGEVMSVGRTFEEAIQKAIRSTDYSNLGFNQTDME
IDIDFELNNPSDLRIFAIANAFAKLGYSVDKVWEMTNIDKWFLNKLYDLVTFSNKVADFG
TKEKLPSIVLKQAKQLGFDDRQIASFLNSNEVAIRRLRKEYGITPFVKQIDTVAAEFPAY
TNYLYMTYNAATHDVDFNDNGVMVLGSGVYRIGSSVEFDWCAVTAVRTLRANKVKTIMVN
YNPETVSTDYDEADRLYFETINLERVLDIYEIENSAGVIVSMGGQTSNNIAMSLHRENVK
ILGTSPEMIDSAENRYKFSRMLDQIEVDQPAWKELTSMEEAEEFAENVGYPVLVRPSYVL
SGAAMNTVYSRDDLESYLNQAVEVSRDYPVVITKYIENAKEIEMDAVAKDGELVMHVVSE
HVENAGVHSGDATLIVPPQDLAPETVDRIVVATAKIGKALKITGPYNIQFIAKNNEIKVI
ECNVRASRSFPFISKVVGVNLIELATKAVMGIPFTPYPVEKLPEDYVAIKVPQFSFPRLA
GADPVLGVEMASTGEVATFGHSKYEAYLKSLLSTGFKLPKKNILLSVGSYKEKQELLPSV
KKLYNMGFKLFATAGTADFISEHGIPVQYLEVLNQEDNEKSEYSLTQHLANNKIDLYINL
PSANRFRRPASYVSKGYQTRRMAVDYSVPLVTNVKCAKLLIEALSRNLTLDVSERDAQTS
HRTVTLPGFINIATFAPNCSNVIKGPEELKEVSRLSLESGFTYCQLMARSTTGPIISDAT
SLKAAYSASQDSSYTNFSFTVAGTANNNDSIAQTAKDVSALFLPFRELTNKVSTVAELLK
NWPVDKQVITEAKTSDLASVMLLASLQNRSIHITGVSNKEDLSLIMTVKDKDSKVTCDVN
IHALFVSQNDYPEAQFLPSKEDQDFFWQNLDAIDAFSIGALPTKLAQITGNKIDTGLGIK
DALPLLLSAVDEGKLTIDDIVERLHENPAKIFNIPEQLDSVVEIDLDYSFVHTKRWSPYT
KGGLNGGVERVLIDGETVVLSGELVAAEPKGKVMTTANVPPTPVTANETPLSMPPLNVKR
RFSFSNERHNSFTSIDGEAEGEYDQPLEQRLMSSRPPKELVAPGAIHNLIRSNNPFKGRH
VLSVRQFKRSDFHALFAVAQELRAAVEREGVLDLMKGRVITTIFYEPSTRTSSSFIAAME
RLGGRTVNINPSSSSVKKGETLQDTIRTLACYSDAIVMRHPDEMSAHIAAKYSPIPIVNG
GNGSREHPTQAFLDLFTIREELGTVNGITVTFMGDLKYGRPVHSLCRLLQHYQVRINLVS
PNELRLPTALRKELAEAGLLGVESEMITPDIISKSDVLYCTRIQQERFENKDEYERLKDV
YVVDNKILSHAKKHMAVMHPLPRVNEIKEEVDYDHRAAYFRQMRYGLFVRMALLAMVMGV
DL
NT seq 6669 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctattattcctacggctcccgtgactcctccaatggaggctacgggtgataga
atgatcgctttagagctcaaggacggtacttcgctgctaggttactcctttggtgccccc
aaatcgaccgccggtgaattggttttccaaaccggtatggtcggatatccagagtctgtt
acagacccttcctatgaaggtcagatcctggtgatcacttttcccttggtcggtaattat
ggtgtgccagatcgtcaattgatcgacgaatatgtggaaggactgcccagatactttgaa
agtaacagaattcatgttgctgggttggttatttctcattatacagaggaatattcccac
tggttggctaaatcgtcactgggcagatggttacaagaagaaggtgtgccagctgtatac
ggtgttgacacaagagctttgacaaagcatttgagagataagggttccatgcttggtaga
ttggctttgcaaaagaacaattctaaggatatcgatgttggttctgcgcaatggaaggac
gcattcgatgttcctgaatgggttgatccaaatgttcaaaatttggttgcaaaagtttct
agaaaggaaccacacttgtatttgcctccaactgaccacgaaggcgttactttgcagaag
ggcccagacggtaagactttaagaattttggccatcgatgtgggtttgaaatttaaccaa
attcgttgttttgtgaaacgtggtgtcgaattgaaggttgtcccttgggattacgatttc
actcaggaacagtatgatgggttgttcatctccaacggtccaggtgacccttcggtgcta
actgatttgtgcaacagactggcgcaagttatccaagcaaagaagactcctatttttggt
atttgtttgggtcaccaattgcttgccagagcaagcggtagctctactttaaaattgaag
ttcggtaaccgtggccataacattccttgtacttctaccatcagcggaagatgttacatc
acttcccaaaatcacggtttcgcagtcgatgccgattccttaaccgacggttggaagcct
ctgttcactaacgccaacgatttctcgaacgaaggtatctaccattccgagttgccgtat
ttttcagtgcaattccatcctgagtctactccaggcccaagagacactgaatttttgttc
gatgtcttcattcaggccgtaaaggaacacaaagcttctggtgttttgaaacctgttgag
ttcccaggaggtaaactcgaggataacagaaacgctcacccaagagttgaaccaaagaag
gttttggtgctgggttctggtggtttgtccatcggtcaagccggtgaattcgattactca
ggatctcaagctatcaaagctttgaaggaggaaggtatttacactatcttgatcaatcca
aacattgccactattcaaacatccaagggtttggctgacaaagtttatttcttgcctgtc
accgctgaatttgtcagaaaggttatcttacatgaacgtccagatgcaatctacgtgact
ttcggtgggcaaactgccttgtctgtcggtatcgaaatgaaggacgaatttgaaactttg
ggtgttaaagttctaggtaccccaattgaaacagtcattacaacagaggatcgtgaattg
ttcgctcaagccatgaaccagatcgacgaaaagtgtgccaagtctcaagctgctaactct
gtcgaggaagctttggccgccgtcaaggagattggtttcccagtcatcgtccgtgccgct
tacgctctaggtggtttgggttctggttttgcctacaacgagaaggaattggtcgatctt
tgtaacgttgcattcgcttcttccccacaagttttagtcgagagatctatgaagggctgg
aaggaagttgaatacgaagttgtccgtgatgccttcgataactgtatcaccgtctgtaac
atggaaaactttgatccattgggtatccacactggtgattcgattgttgttgctccatct
caaactctgtcagacgaggattacaacatgttgagaactacagccgttaatgtcattaga
cacttgggtgttgtcggtgaatgtaacattcaatatgccctcaaccctttctccaaggaa
tactgcatcattgaggttaacgctcgtctttctcgttcttctgctctggcttcaaaggcc
actggttacccactggcttacactgctgccaaactaggtttgaatattccgctgaatgaa
gtgaccaactctgtcactaaatcgacttgtgcttgtttcgaaccatccttggattactgt
gtcgtcaagatgccaagatgggatcttaagaaattcacaagagtttctaccgctttgtcg
tcatcaatgaaatctgtgggtgaagtcatgagtgttggtagaactttcgaagaagcaatc
caaaaggccatcagatcaactgactacagtaacttgggtttcaaccagactgacatggaa
atcgacattgactttgagttgaacaatccatccgacttgcgtatctttgctattgccaac
gcttttgctaagttgggttattcagtcgataaggtttgggaaatgaccaacattgataaa
tggtttttgaacaagttgtatgatttggtcacattttctaacaaggttgccgatttcggt
accaaggaaaagctgccttcgattgttttgaagcaagccaagcaacttggtttcgatgat
agacaaattgccagtttcttaaactctaacgaggttgctattcgtcgcttgagaaaggaa
tacggtatcacaccttttgttaagcaaattgataccgttgcagctgaattccctgcttat
accaattacttgtacatgacttataacgccgctacgcatgacgtagatttcaatgacaat
ggtgtgatggtccttggttctggtgtctaccgtattggttcctccgtcgaattcgattgg
tgtgcggtcactgcagttagaactctgcgtgctaacaaggtcaagactatcatggttaac
tacaacccagaaacagtctctacggattatgatgaagctgacagattgtatttcgaaaca
atcaaccttgaaagagttttagatatttacgaaattgagaactcagccggtgttatcgtc
tccatgggtggtcagacttcaaacaatatcgctatgtctctacatcgtgaaaatgtcaag
attttaggaacatcaccagaaatgattgatagcgctgaaaaccgttacaaattttcccgt
atgttggatcaaatcgaagttgatcaaccagcttggaaggaacttacttccatggaagaa
gccgaggaatttgccgaaaacgtcggctacccagtcttggttcgtccttcctacgttttg
tccggtgctgcaatgaacactgtttactcgagagatgacctggagtcatacttgaaccaa
gccgttgaagtttctcgtgactaccctgttgtcattaccaagtatattgaaaacgcaaag
gaaattgagatggatgctgtcgccaaagatggtgaattggttatgcatgtggtctccgag
catgttgaaaatgctggtgttcattctggtgatgctactttgattgtccctccacaggat
ttggctcctgagactgtagacagaatcgttgttgcaacagctaaaattggtaaggctttg
aagatcactggtccttacaatattcaattcattgccaaaaacaacgagattaaggtcatc
gaatgtaacgttcgtgcttcccgttctttcccatttatttccaaggtcgttggtgttaat
ttaatcgaattggctaccaaagccgtgatgggcattcctttcactccttatccagttgaa
aagttgccagaagactatgtggcaattaaggttccacaattctctttcccacgtcttgct
ggtgcagacccagttcttggtgtcgaaatggcctctactggtgaagttgccacctttggt
cattctaaatatgaagcatacttgaaatctttgttgtcaacaggattcaagctaccaaaa
aagaacattttgctatcggttggttcttacaaggaaaagcaggagctacttccatcagtc
aagaagttgtacaacatgggcttcaaattgtttgcaacagctggtactgcggacttcatc
tctgaacatggtattcccgttcaatatcttgaagttctgaaccaggaagacaatgagaaa
tcggaatactctcttactcagcacttggctaacaacaagattgacttgtatatcaatttg
ccttctgctaataggttccgtcgtcccgcatcctatgtttcgaagggttaccaaactcgt
cgtatggctgttgattactccgttcctttggtgaccaacgtcaagtgtgcaaagttgtta
atcgaagctttgtcgcgcaacttgacacttgacgtttctgagcgtgatgctcaaacctct
cacagaaccgtcacccttccaggttttatcaacattgcaacctttgctcctaactgttca
aatgtgattaaaggtccggaagagctgaaggaggtgtctcgtttatccttggagtccggt
ttcacttactgtcaattgatggctagatctaccactggcccaatcatctctgatgctact
tccttgaaggctgcttactctgcctctcaagattcttcatacaccaatttctcattcact
gtcgcgggtactgctaataacaacgacagcatcgctcaaactgcgaaggatgttagtgct
ttgtttttgccattccgcgagctcaccaataaggtttcaactgtcgcagagttgctgaag
aactggcctgtcgacaagcaagttattaccgaagcaaagacctctgatttggcatctgtt
atgttattggcttcgttgcaaaacagatcgattcacatcactggcgtctctaacaaggaa
gatctgtctttgattatgactgttaaggacaaagattcaaaggttacttgtgatgtcaac
attcatgctttgttcgtttctcaaaatgattacccagaggcacaattcttgcctagtaaa
gaagatcaagatttcttctggcaaaatctcgatgccattgatgccttctctatcggtgct
ttaccaaccaagcttgcccaaattaccggtaataagattgatactggactcgggatcaag
gatgcactaccattgttactttccgccgttgacgaaggtaagttgactattgatgatatc
gttgagcgtctacacgaaaacccagccaaaatttttaatattcctgaacaacttgactct
gttgtggagattgatctcgattattccttcgttcacactaagagatggtcaccttatacc
aagggtggcttgaacggtggggttgagcgtgtgttgatcgatggcgagaccgtcgtttta
agtggtgaactagttgctgctgaaccaaagggtaaggtcatgactacagccaacgttcct
ccaactccagtcactgctaatgaaactcctttgagtatgcctcctttaaacgtgaagagg
agattttctttctcgaatgagagacacaactctttcacaagcatcgatggcgaagcagag
ggtgaatatgaccaaccattggaacaaagattgatgtcatccaggcctccaaaagagctt
gtcgcccctggcgctattcacaacttgatacgcagcaataatcctttcaagggtagacac
gttttgtctgtgagacaattcaagagatcagacttccatgccttattcgctgtcgcacaa
gaattgagagctgctgtggaacgtgagggtgttctagatttgatgaagggtcgtgttatc
actaccattttctatgagccttcgactcgtacatcttcctctttcatcgctgccatggaa
cgtctaggtggtagaactgttaacatcaatccttcttcctcatcagtgaagaagggtgag
actttgcaagacaccatcagaactttagcctgctactctgatgctatcgtgatgcgtcat
ccagatgagatgtctgctcacattgccgccaagtactcgccgatcccaattgtgaacggt
ggtaatggttctcgtgaacatccaactcaggctttcttggatctcttcactattcgtgaa
gagctaggtacagtgaatggtatcacagttacctttatgggtgacttgaaatacggaaga
ccagtgcactctctatgccgtttgttgcaacactaccaggtcagaatcaaccttgtctct
ccaaatgaactcagattgcccactgctttgcgcaaggagttggctgaggccggcttgttg
ggtgtcgaaagcgaaatgatcactcctgacattatctccaaatctgatgttctgtactgt
acaagaattcaacaggagagatttgagaacaaggatgaatacgaacgtttgaaggacgtt
tatgtcgtcgacaacaagatcttgtctcacgccaagaaacacatggctgtcatgcatccc
ctacctcgtgttaatgagatcaaggaagaagttgactacgaccatcgtgctgcatatttc
agacagatgagatacggtctctttgttagaatggccctattggccatggtcatgggtgtc
gatctataa

DBGET integrated database retrieval system