KEGG   Torulaspora delbrueckii: TDEL_0H01070Help
Entry
TDEL_0H01070      CDS       T02236                                 

Gene name
TDEL0H01070
Definition
hypothetical protein
Orthology
K11227  
mitogen-activated protein kinase kinase [EC:2.7.12.2]
Organism
tdl  Torulaspora delbrueckii
Pathway
MAPK signaling pathway - yeast
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Environmental Information Processing
  Signal transduction
   04011 MAPK signaling pathway - yeast
    TDEL_0H01070 (TDEL0H01070)
Enzymes [BR:tdl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     TDEL_0H01070 (TDEL0H01070)
Protein kinases [BR:tdl01001]
 Serine/threonine protein kinases: STE group
  STE7 family
   TDEL_0H01070 (TDEL0H01070)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(192834..194624)
Genome map
AA seq 596 aa AA seqDB search
MNEQFSKLSLGQEGRKADGSSAGTPGQVSSSSSSHYGNINANLHARVKAFQEQRALKRTG
SVGSNKSETDSSGKVKNAQEMQQIVNKPLPPLPAADQAEAQAVLEQRSERKEGSLDNKAQ
FNPSRRAPRRPPTARPVAQGISSQPAQSLSARRGLKLPMGGMSLKLPGKTEKPTHSTQEF
ASTPSNSNHIIASTTTVSGGVGGNRSNPGSLVNGIQSTSTSSSNEEQRDTEGTAPRNTNS
NSGGLFANFSKYVDIKSGSLNFAGKLSLSSEGIDFGNGNSSRITLDELEFIEELGHGNYG
NVSKVLHKPNNVIMAMKEVRLELDEAKFRQILMELEVLHKCQSPYIVDFYGVFFIEGAVY
MCMEFMDGGSLDKIYDASPEMGGIDEPQLAYITHAVIEGLKELKDVHNIIHRDVKPTNIL
CSAKHGTVKLCDFGVSGNLVASLAKTNIGCQSYMAPERIRSLNPDRVTYTVQSDIWSLGL
SILEMALGRYPYPPETFDNIFSQLSAIVDGPPPKLPREKFSSDAQDFVSVCLQKIPERRP
TYAALLEHQWLKKYKDVDVEMSNYITTRLHKRKELLAERGEKELPKHLPALHMGGL
NT seq 1791 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagcagttttctaaattatcacttggtcaggaaggtagaaaggcggatggttcg
agtgcagggactccaggacaggtttcgtcaagttcttcctcgcattatggtaatataaat
gctaatttgcatgccagggtgaaggctttccaggagcagagggcccttaaaagaactggg
agtgttgggagtaataagagtgagactgatagtagtggaaaagtgaagaatgctcaggaa
atgcaacagattgtcaataaaccgttgccccctctgcctgcagcggatcaagctgaggct
caagcagtgctggaacagcgttcagaacgaaaggaaggctctttggataataaggcacag
tttaaccccagtaggagggctccaagacgacctccaacggccagacctgttgctcagggg
ataagtagtcaaccggcacagagtctgagtgcacgtcgaggtttgaaattgcctatgggg
ggtatgtcgctgaaattgcccgggaagactgagaaaccgacgcattcgactcaggaattt
gcatctacaccttctaatagtaaccatataattgcttcaactacgactgtgagtggcggg
gtaggtggtaataggtcaaatccggggtctttagtcaatgggatccaatcgacgtcgact
tcgtctagtaacgaggagcaacgtgatacggagggtactgcgccaagaaataccaacagt
aattccggtggtttgtttgccaatttctccaagtacgttgatattaagtcaggctctctg
aatttcgctggtaaattatcgttgtcctcggaaggtatcgattttgggaatggtaatagt
tcaaggattacactcgatgaattggagtttatcgaagaattgggccacggtaattacggt
aatgtgtccaaagtactacacaaacccaataacgtgataatggcaatgaaggaggtcaga
ttggaattggatgaggcaaagtttagacagattttgatggaattagaagttctacacaaa
tgtcaatcgccgtatatcgttgatttttatggagtctttttcatcgaaggtgctgtctac
atgtgcatggaattcatggatggaggttcgctcgataagatctacgatgcatcaccggaa
atgggtggcatagatgaaccacaattagcatatattacgcacgcagtgattgaaggtctg
aaagagttgaaggacgtccataatattattcacagagatgttaaaccaacaaatatttta
tgttcagcaaagcacggaactgtcaaattatgtgattttggtgtctcaggtaacttagtt
gcttctctcgccaaaacaaacataggttgccagtcttacatggctccagaacgtatcaga
tccctaaatcccgatagagtcacctacacagttcagtcggatatatggtctcttggccta
agtattttagagatggcccttgggaggtatccatatcctccagagactttcgataacatt
ttctcgcaattaagtgccatcgttgatggcccaccaccaaaactacctcgtgagaagttc
agttcagatgcacaagatttcgtctctgtgtgtttacaaaagatcccggagagaagaccc
acttatgctgctctcttggaacatcaatggctgaagaagtacaaggacgttgacgtcgag
atgagcaattatatcacaacaaggctacacaaacggaaagaactgcttgctgaaagaggt
gagaaagaacttccaaaacaccttcctgcattgcatatgggcggcttgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system