KEGG   Torulaspora delbrueckii: TDEL_0H01410Help
Entry
TDEL_0H01410      CDS       T02236                                 

Gene name
TDEL0H01410
Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tdl  Torulaspora delbrueckii
Brite
Protein phosphatases and associated proteins [BR:tdl01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     TDEL_0H01410 (TDEL0H01410)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:join(240642..240693,240799..241274)
Genome map
AA seq 175 aa AA seqDB search
MGVASSKVIDNLLEDTNFDGDEIERLRKRFMKLDRDSSGSIDKNEFMMIPGVSSNPLAGR
IMEVFDADNNGSVDFQEFISGLSIFSGRGSKDEKLKFAFKIYDIDKDGYISNGELFIVLK
IMVGNNLDDEQLQQVVDRTIVENDSDGDGHLSFEEFKNAIETTEVAKSLTLQYDV
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atgggtgttgcttcttctaaagtcattgacaaccttctggaggatacaaatttcgatgga
gatgagattgaaagattgaggaaacgttttatgaaactcgatagggacagttctggttca
attgataaaaatgagtttatgatgattcctggggtatcatctaatcctctagccgggcga
ataatggaagttttcgatgccgataataatggtagtgttgatttccaggaattcatatct
ggtctgtctatattcagtggtcggggaagcaaagatgagaaattaaagtttgcctttaag
atatatgacatagacaaggatggatatatatcaaacggtgaactgttcattgtgcttaaa
ataatggttgggaacaacttggatgatgaacaactgcaacaggttgtggacagaaccatt
gtggaaaatgatagtgatggtgatggacatttgagcttcgaagaatttaagaacgccatt
gagacaaccgaagtggccaaaagtttgacacttcagtatgatgtatga

  All links  
No link information was found.   
DBGET integrated database retrieval system