KEGG   Torulaspora delbrueckii: TDEL_0H01970Help
Entry
TDEL_0H01970      CDS       T02236                                 

Gene name
TDEL0H01970
Definition
hypothetical protein
Orthology
K01637  
isocitrate lyase [EC:4.1.3.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Class
Metabolism; Overview; Carbon metabolism [PATH:tdl01200]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:tdl00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:338582..340249
Genome map
AA seq 555 aa AA seqDB search
MDATTLDYQTLKKQLGASAREIEQWWSDPRWKNTKRIYSAQDVAARRGTFPPIQYPSSVQ
AKKLYKVLQEHRKRGTVARTFGALDPIHISQMAKYLDTIYVSGWQCSSTASTSNEPGPDL
ADYPMDTVPNKVDHLFKAQLFHDRKQLENRAKATSQKELDAQGPPIDYMTPIIADGDAGH
GGLTAVFKLTKMFIERGAAGIHMEDQTSTNKKCGHMAGRCVIPVQEHVNRLSTVRMCADI
MHSDLVIVARTDSEAATLISSTIDVRDHYYVVGATNPEVEDQPFAEVMDKAILAGASSSE
LAQIEAQWCKKAGLKLFHEAFAEELQKSNVSNKERVLAEFQRKVGPYTGTPHREAQKLAK
KLLGHEVYFNWDVPRVREGLYRYQGGTQCAVMRARAFAPFADLVWMESNYPDYPQAKQFA
EGVREEFPNHMLAYNLSPSFNWTKAMSTEEQGTFIERLGKLGYNWQFITLAGLHTTALAV
NNFSREFAKHGMKAYAQNVQQKEMDEGVDVLKHQKWSGAEYIDSLLKLAQGGVSATAAMG
QGVTEDQFKEDKSKL
NT seq 1668 nt NT seq  +upstreamnt  +downstreamnt
atggacgctactacactagattatcaaactttgaagaaacaattgggtgcttctgcccgt
gaaattgaacaatggtggtctgatcctcgttggaaaaatacaaagagaatatattctgct
caagatgtcgctgctagacgtggaactttccctccaattcaatatccttcatctgttcag
gctaagaaattgtacaaagttttgcaagagcatagaaaacgtggaactgttgcacgtact
tttggtgcattggatccaatccatatctctcaaatggccaaatatttggatactatttac
gtttctggttggcaatgttcttcaactgcctcaacttccaatgagccaggtcctgattta
gctgattacccaatggatactgttccaaacaaggtggatcatcttttcaaagcacaatta
ttccacgataggaaacagcttgaaaatagggcaaaagctacttctcaaaaagagttggat
gctcagggtcctccaattgattatatgactccaatcatcgctgatggtgatgctggtcat
ggtgggttgactgctgtgtttaagttgaccaagatgttcatcgaacgtggtgctgcgggg
attcatatggaagatcagacttctacaaacaagaaatgtggacatatggctggtcgttgt
gtcattccggtgcaagagcatgtcaatagactctcaaccgtgagaatgtgcgctgatatt
atgcattcggacttggtcattgtcgctagaactgactcggaagctgctactttgattagc
tcaactatcgatgtccgtgatcactactacgttgtcggtgcaacaaatcctgaagtcgaa
gatcaaccatttgcagaagtaatggataaagctatccttgcaggtgcgtcttcttctgaa
ctcgcgcagatcgaagctcaatggtgcaagaaagcaggtcttaaattgttccatgaagca
ttcgctgaagaattgcaaaaatccaacgtttcaaacaaagaaagagtactagctgagttc
caaagaaaagttggaccttacactggtactcctcaccgtgaagctcaaaagctagctaaa
aaacttttgggccatgaagtctacttcaactgggacgtgccaagggtcagagaaggcctg
taccgttaccaaggtggtacccagtgtgcagtgatgcgcgcacgtgcgttcgctccattc
gctgacttggtttggatggagagtaactatccagactacccacaggctaagcaatttgcc
gagggtgttagggaagaattccctaaccacatgcttgcttataacctatcaccatccttc
aactggaccaaagcgatgtccacagaagaacaaggtactttcatcgaaaggctcgggaaa
ctgggttacaactggcaattcatcaccttagctgggttacacaccactgcactagcagtg
aacaacttctctcgtgaatttgccaagcatggaatgaaagcctacgcacagaacgttcaa
cagaaggaaatggacgaaggtgtcgacgttctaaagcaccaaaaatggtccggtgcagaa
tatatcgacagtttactcaagttagcccaaggtggtgtctctgctacagctgccatgggt
caaggtgtcaccgaggaccagttcaaggaagataagagtaagttatag

DBGET integrated database retrieval system