KEGG   Torulaspora delbrueckii: TDEL_0H02090Help
Entry
TDEL_0H02090      CDS       T02236                                 

Gene name
TDEL0H02090
Definition
hypothetical protein
Orthology
K12345  
3-oxo-5-alpha-steroid 4-dehydrogenase 3 [EC:1.3.1.22 1.3.1.94]
Organism
tdl  Torulaspora delbrueckii
Brite
Enzymes [BR:tdl01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.22  3-oxo-5alpha-steroid 4-dehydrogenase (NADP+)
     TDEL_0H02090 (TDEL0H02090)
    1.3.1.94  polyprenol reductase
     TDEL_0H02090 (TDEL0H02090)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:353919..354680
Genome map
AA seq 253 aa AA seqDB search
MDAEDSISRYVIIGYRLTFLVGLSSVAVANYLLPELLQYGKTFVPDNPHRKDAPLWQRLF
YATVPKGRFAHFYYLSTFLSMINLYSYHGSPIAWLILFHSVRRAYETTYVSKYTPTSRMH
WSHYVVGIWFYSVLNLMINIKLHQGAVSSALKPVPFLIFCFASWDQYKNHRILSRLVKYS
LPTEGLFQIVCCPHYLDEVLIYASLIPYNWEFSWLLIWVFTNLSVSARENKNYYDHRFPK
ARVPQYAIIPLVL
NT seq 762 nt NT seq  +upstreamnt  +downstreamnt
atggatgctgaagattcaatttcaaggtacgtaattataggttacagactaactttcctt
gttggtttaagctcagtggcagtggccaattatcttttaccggagctcttgcaatatgga
aagacttttgtaccagacaacccacacagaaaagatgcaccattgtggcaaaggctgttc
tacgcaacggttccaaaaggtcgttttgcccatttttactacttatcaacatttttgtcc
atgataaatttatacagttatcatggctctccaattgcttggctaatactattccattca
gttcgtcgggcatacgaaactacttacgtttccaaatatactccaacttccagaatgcat
tggtcacattatgtcgttggtatatggttctactcagtgctcaacctaatgatcaatata
aagctgcaccaaggtgctgtatcttcagcactaaaaccagtgccatttcttatattttgt
tttgcctcctgggatcaatacaagaaccaccgaattttatcaagattggtgaaatattcc
ttgccaacagagggactcttccaaatagtatgctgtcctcattacctcgatgaggtattg
atttacgcctcgttaatcccatataattgggaattcagctggctactgatctgggtattt
acaaatttgagcgtttcagcccgggagaacaaaaattattacgaccacaggttcccaaag
gccagagtgccccagtacgccattatacctcttgtattgtaa

DBGET integrated database retrieval system