KEGG   Torulaspora delbrueckii: TDEL_0H02200Help
Entry
TDEL_0H02200      CDS       T02236                                 

Gene name
TDEL0H02200
Definition
hypothetical protein
Orthology
K00326  
cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tdl  Torulaspora delbrueckii
Pathway
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tdl00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(372192..373043)
Genome map
AA seq 283 aa AA seqDB search
MADNSSRIVIALIVLVAIILVGRVLSKRQRPAVLIPDQFQEFPLIMKTNLTHNTALYRFG
LPGADDVLGLPIGQHISIRAEIEGKEILRSYTPTSLDTDAKGCFELLVKTYEKGNISKVI
GELNIGDKIQVRGPKGFYQYMPNMYTHIGMVAGGTGISPMYQIIKAIATNPADRTKVFLV
YGNVTEDDILLKAELDAIVRSNPAQFKVRYLLDKPPADEWEGGVGYVTEEVMREYLPSAK
EPAVQLLICGPRPMVSSVKKTAVTLGFDKAKPISKMGDQVFVF
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctgacaactctagtcgtattgtgattgcacttattgtgctagttgcaatcattttg
gttgggagagtactctccaagcgtcagagaccagcagttttgatcccggatcagtttcag
gaatttcccttgatcatgaagaccaatctcactcataatactgcactgtatagattcgga
ttgccaggtgccgatgatgtcttgggtttaccaattggtcaacacatttcgatcagagct
gagatcgaaggtaaggaaattctgaggtcatatactcctacttcattggatactgacgct
aagggttgttttgaattgctagtcaagacatatgagaaaggtaacatttccaaagttatt
ggggaattgaatatcggggacaaaattcaagttcgtggtccaaaagggttctatcaatac
atgcccaacatgtacacccacattggaatggtggctggtggtactggtatctcacctatg
taccagatcatcaaggctatcgccactaatccagcggatagaactaaagtgtttctcgtc
tatggtaatgtgaccgaggatgatatcttattgaaagctgaattggatgcgattgttcgt
tcgaacccagcccagtttaaggtccgctatttgctggacaaaccaccagccgatgagtgg
gaaggcggtgtaggttatgtcactgaggaagttatgagagaatatctaccaagtgcgaag
gagcccgctgttcaactgttgatctgtggtcctcgtccaatggtctcttctgtcaagaaa
acagccgtaacactgggctttgacaaagctaaaccaatttcaaagatgggagaccaagtc
tttgtcttttag

DBGET integrated database retrieval system