KEGG   Torulaspora delbrueckii: TDEL_0H02810Help
Entry
TDEL_0H02810      CDS       T02236                                 

Gene name
TDEL0H02810
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
tdl  Torulaspora delbrueckii
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tdl00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(465456..467048)
Genome map
AA seq 530 aa AA seqDB search
MLSPLTKLPTNAKVAVVGSGVAGLMFTYFLGKLRPDVTIHLIESQKRTGGWIKSLDTKDK
NNEPVMLEQGPRTLRGVSDGTVLIVDTLKDLNQQSIVQCISANAEANRKFLLDPNDKLAQ
VPNSPATAIEFLCNPLGKGLITGFLGEPFRRPPSHPGQDESVSSFIKRRFGSDYIGNNIL
SAVFHGIYGDDIDNMSAKRTVRKLFDLETKYGSIMKGFYNSKSDPNEKHQLSQLLSDYQR
AFNKDEAELKGLSTKLHKYPMLGLKGGLEMFPHLVRQSLNKLSNVNLISGEKVIKINQGK
EQEGLSVQLSQGKSLTGLNHVRLTPTPARISPMIDNEQLAKEFAKIKANSILLVNFYLPK
KDAIARKYHGFGYLCPKSSKNPQGLLGVIFDSVIERSFQPLFQNMDANQKSSSPEQYTKL
TAMLGGHYLNHHSSETVPSQELTIRAVKDSLNTHLGISSQDLEDGMWAFTVAEKCLPRFS
VGYDAWQASVEQELQKAYKGTVSVGGMGFAKGPGVPDVIADGLQDAIKLA
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgttaagcccgcttacaaagttaccgactaatgccaaagtggcagtcgttggaagtggt
gttgccggcctgatgttcacttatttcctaggtaaactaaggcctgatgtgacaatccac
ttgatagagtctcaaaaaagaactggtggatggatcaaatccttggataccaaggataag
aataatgaaccagtgatgttagagcagggtcctcgtacgcttagaggcgtctccgacgga
acagttcttattgtcgataccttgaaggatctcaatcaacaatcaattgtacaatgcatc
agtgcgaatgcagaggccaataggaagtttctgttagacccaaatgacaagttggctcaa
gttcccaattccccagcgaccgctatagagtttctatgcaatcctctcggcaagggactc
atcactggtttcctaggcgaacctttcagaaggcctccgagccacccaggccaggatgag
agtgttagctcatttatcaagaggcgatttggaagtgattatattggtaataatatatta
agtgctgtcttccatggaatatatggggacgatatcgacaacatgagtgccaaaaggacc
gtgaggaaattgtttgatttggagactaagtacggttcgattatgaaaggtttttacaac
agtaaatctgatcctaatgagaaacatcaattgagtcagctactaagcgactaccaacga
gcattcaataaggatgaggccgagttgaagggactttccactaaattgcacaagtatccc
atgctaggcctgaagggaggtctggagatgtttccgcatctcgtcagacaaagcttgaac
aaactatcaaacgtgaatttgataagcggcgaaaaagttatcaagatcaaccaaggcaaa
gaacaggagggactcagcgtgcagttgtcacagggaaagtctctcaccggcctcaaccat
gtcagattgaccccaactccagcgcgaatctcaccaatgattgacaacgaacaactggcc
aaggaatttgccaagatcaaggcaaatagtatattacttgtgaatttttacctgcccaaa
aaagacgccatagctaggaaataccatggcttcggctatctttgtcccaaatcaagcaaa
aaccctcaaggactactcggtgtcatcttcgactctgtcatcgaaagaagttttcagccg
ctattccagaatatggatgcaaaccagaaatcatcttcacccgaacagtatacaaagctt
accgctatgctaggggggcactacttgaatcaccattcgtcagagacagtaccgtctcaa
gagcttaccatccgcgcagtaaaagactcacttaacacccacttaggaatctcatctcag
gaccttgaagacggtatgtgggcatttaccgtcgctgaaaagtgtctccctcgcttctca
gtcgggtacgacgcttggcaggcttcggtcgagcaagaacttcagaaagcatacaaagga
accgtctcagtgggcggaatgggctttgctaagggacctggagttcccgacgtcatcgct
gatggtttacaggacgccatcaagctagcatag

DBGET integrated database retrieval system