KEGG   Torulaspora delbrueckii: TDEL_0H02970Help
Entry
TDEL_0H02970      CDS       T02236                                 

Gene name
TDEL0H02970
Definition
hypothetical protein
Orthology
K13996  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
tdl  Torulaspora delbrueckii
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    TDEL_0H02970 (TDEL0H02970)
Enzymes [BR:tdl01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     TDEL_0H02970 (TDEL0H02970)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:493481..495580
Genome map
AA seq 699 aa AA seqDB search
MWNPWFIALYLLWSGVFAILEQQEKPQFPEPLNEEGFNTQLKAGLHVVEFYSPNCHHCKA
LAPTWEKTWETFYEEGKALHIAFSQVNCLLSGDLCAKEKIGYFPTIRLYGPSGVIKNFPD
DAKRSMENLIDFARREANDPSNSEIVDIKSTSIQLSGDKFNQLLDGRGSQPILVSFWPSK
AMRSTDDDMEFENCEDCRPFQRTWRVLSSRLLSSSISTGHVNCESSAKLCEELGFDDLVK
IRNHSYERLPRVALIIPGRKVNNLFIYESKFSTSVSDYEDFATRVTRNSEAPFISSSDVK
QIAERDFQLSASSAFASPPQNLHIVFAYNPKTVVQEDFAVLDHLVEPLSNIPNAYLYKST
DDMKQTSRSNLDSLYKIMNSNLDGPEKTIKEEFIDLNVMDQNPTFYVFRDGDRIPHVFPG
YSTTEVRDVDRIVTWIESLSLPFMNEVSTSNFKELLNFIPEEYSGLAIQLIDTSSPVLFE
KSSRFLEKFMLAGYDYEDFRMGYVVNVTSAERAKKSKKMSDLKGKGASAKKRIQAAIQDV
PHVDDNKVVLGYIDISKSSNTLSNMGLAHRGDTYKAGDVIIINKVTKFVYEHNAAGDVLT
SESSSKIKNALISALLPKATPSPPRISGHLLSTPFGDSFRFLDSLHQFGFFGYLGLLSVV
LFSYKILRFYSRSKVNRKYKAKRNTLGILGKSNQKKLRD
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atgtggaatccgtggttcattgctctatacctgctttggtcaggagtatttgcaatatta
gagcaacaagagaaaccgcaatttccagagcctttgaatgaagagggtttcaacactcag
ttaaaagcgggactgcatgtcgtcgagttttatagtcccaattgtcatcattgtaaagct
ttggcaccaacctgggagaaaacttgggaaacattctatgaagagggtaaagcacttcat
atagctttctcccaggttaattgtttgttaagcggagatctttgcgctaaggaaaagatc
ggttacttcccaactatacgtctatatgggccttctggggtcatcaaaaactttcctgat
gatgcaaagagatcgatggagaatttaatcgatttcgctcgtcgcgaggccaatgatcca
tctaattcagaaatcgtcgatattaagagtacaagtatccaactctcgggtgataaattc
aatcagttacttgatgggaggggcagccagcccattttggtctccttttggccgtcaaag
gcaatgagaagcacagatgatgatatggagtttgagaattgtgaagattgccgtcccttc
caaagaacatggagggttctctcttccagacttttatcttctagcatttccaccggccat
gtcaactgtgaatcatctgcgaagctttgtgaagagttaggcttcgatgatctggttaag
attagaaatcactcatatgagagacttcctagggttgctttgatcatacccggaagaaag
gttaacaatttgttcatttacgaatcaaagttctcgacttcagtttctgattacgaagat
ttcgcaacaagggtcactagaaatagtgaagctccattcatctcatcttccgacgtaaag
caaatagcggaacgggactttcaactctctgcatcttctgcatttgcttcgcctcctcaa
aatttgcatatagtgttcgcatataacccaaagactgttgtgcaagaggattttgctgta
ttagaccatttggtcgaaccgctgtcgaacatacccaatgcctatctctacaagtctact
gacgacatgaagcagacaagtcgttcgaaccttgattcgctttataagattatgaattct
aatttggacgggccagaaaagactataaaggaagaattcatcgatttgaacgttatggat
caaaatcctacgttttatgtattcagggatggagacagaatccctcacgtatttcctgga
tactccactacagaagtgagggacgtcgatagaattgttacgtggatcgaatccttatct
ttgccgttcatgaacgaggtctcaacctcgaacttcaaagaacttctaaactttatacct
gaagagtacagtggtttagctatccaattgatcgacacttctagtcctgttctattcgaa
aaaagcagcagatttctggaaaagttcatgttggctggctacgattacgaagatttcaga
atgggatacgtcgtgaatgttacaagtgcagaaagagccaagaagtctaaaaaaatgagt
gatttgaagggaaagggcgcatcggcaaagaagagaattcaggcagctatccaagatgtt
cctcatgtggatgacaacaaagttgttttaggctatattgacatttcgaaatcaagcaac
acattgtccaacatgggtctagcacaccgtggagatacttacaaagctggggatgtaatt
attatcaataaagtcaccaaattcgtttacgagcataatgccgctggagatgtattaacc
tcagaatcgtcaagcaagatcaaaaacgcattgatatcggctcttttaccgaaagcaacg
ccatcaccaccccgaatttcgggccatctgttgagcacgccatttggagattcattcaga
tttttagattcgcttcatcaatttggattctttggttaccttggccttctctcggttgta
ctattctcttacaagattctacgtttttacagcagatcaaaagtcaaccggaagtacaag
gccaagagaaacactttaggcattcttgggaaatcaaatcagaagaagttacgagactaa

DBGET integrated database retrieval system