KEGG   Torulaspora delbrueckii: TDEL_0H03380Help
Entry
TDEL_0H03380      CDS       T02236                                 

Gene name
TDEL0H03380
Definition
hypothetical protein
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
tdl  Torulaspora delbrueckii
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Class
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:tdl00270]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:561672..562205
Genome map
AA seq 177 aa AA seqDB search
MVEAYIHDGNDSVDLREPHNSGTPVSLEELSKLGVFYRYLDTQEDVDNLAKERNYKNRDI
VNISPASFPDEETLKAKLDIFYKEHLHEDEEIRYCLDGEGYFDVRNILSSDWIRIRFERN
DLLIVPAGIFHRFTLTSSNYVKALRLFQDEPKWLAINKPEADLNPTHLKYVESVNSD
NT seq 534 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagcttatattcacgacggcaacgatagtgtagatttgagagaacctcataac
agtggtacacctgtatcgttagaggaattgagcaagttgggcgtcttttacagatatctg
gacacccaggaagacgttgacaatttggcaaaggaaaggaattacaagaatagagatatt
gtcaacataagtccagccagtttccccgatgaagagactttgaaggccaaattggacatt
ttttacaaggaacacttgcacgaggatgaagagataagatattgtctcgatggagaagga
tatttcgatgtaagaaatattctttccagcgattggatccgaatcagatttgaacgcaat
gatttgctcattgtaccagctgggatcttccacagattcacattgacctcgagcaactat
gtcaaggcgctcagattgtttcaggatgagcctaaatggctagcaatcaacaaaccagag
gcagatttgaacccaactcacctgaagtacgtcgaatcagtcaacagtgactag

DBGET integrated database retrieval system