KEGG   Torulaspora delbrueckii: TDEL_0H04290Help
Entry
TDEL_0H04290      CDS       T02236                                 

Gene name
TDEL0H04290
Definition
hypothetical protein
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
tdl  Torulaspora delbrueckii
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:tdl00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    TDEL_0H04290 (TDEL0H04290)
Translation factors [BR:tdl03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    TDEL_0H04290 (TDEL0H04290)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
8:complement(737283..739481)
Genome map
AA seq 732 aa AA seqDB search
MATEFEDIKLEDIPVDDVEFGDLEEKYSVKDEFNFDQYIVVSGAPVIPEAKVPVLKKALT
GLFSKAGKVVDMEFPIDPETKKSKGFLFVECGSPADGNKIIKAFHTKRLDLKHRLYLYTV
RDVERYNSNAFNTEFKEPAMPEFVPSSSLKSWLQDEEVRDQYVLQKDDLTTVFWNTTLED
ADNVVESRENWSSNYVRFSPKGTYLFSYHDQGVVAWGGPHFDRLRRFYHPNVRTSSVSPN
EKYLVSFSADPIIYNEDDKDSPFTKRNEGHQLCIWEIASGLLMTTFPVVKSPFLHWPLIR
WSFNDKYCARMVGGTLVVHDSDNGFAPMENKALKVPGIRDFSFAPSGVKLHPFRQNDEPS
VLLAYWTPETNNMSCKGTIVEVPRGRVLKTVNLVQVSNVSLHWQNNADFLCFNVERHTKS
GKTLFSNLELCKLTEKDIPVEKIEFKDCVRAFEWEPNGNRFVAIAERDTGDDNPAIPRHV
ISFFAPEVKEKEQGSNASTGIKRWKLVVDIPDKFSNTISWSPAGRFVVVATLVKPNVRKS
DFMFFDVDFAGEKNINEAKDVTASVKDIAKPAYLSATDLKWDPSGRYLAAWSSALKHKIE
NGYKIFNVGGDVVKEETVSNFKNFAWRPRPASLLSNAEKKKVRKNLREWSAQFEEQDAME
ADSAMRDLILRQRELLKEWHEYRAESSEKLLKDFGYKAFDVTPLDEDDEQYTVVEEVKEE
ILEEKEEKVQDE
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atggcaactgaatttgaagatataaaactggaagatatcccggtcgatgacgtggaattc
ggcgatttggaagaaaaatacagcgttaaggatgaattcaatttcgaccaatatattgtt
gtaagtggtgcacctgtgattcctgaagccaaggttcctgtcttgaagaaagctttgacc
ggtcttttctctaaagcgggcaaagtcgttgacatggagttcccaattgatccagagaca
aagaagagtaaaggcttcctttttgttgaatgtggttcaccagcagatggtaacaagatt
atcaaggcattccataccaagagactggatttgaagcatagactgtacttgtacactgtt
agagatgttgaaagatacaactcaaatgctttcaacactgagttcaaggaacctgctatg
cctgagtttgttccatctagttctttgaagagctggttgcaagatgaagaggtcagagat
caatatgttctgcagaaggatgatttgactaccgttttctggaatacgacgctagaggat
gcggacaatgttgtggaatcgagggagaactggtccagcaactacgtcagattctctcct
aaaggtacctatctattttcgtaccacgatcaaggtgtcgtcgcttggggtggtcctcac
tttgaccgtctaagaagattctatcatcctaatgtaagaacttcttccgtgtcaccaaat
gaaaaatacttggtctctttctctgcagacccaatcatttacaatgaagatgataaggac
tctcctttcactaagagaaatgaaggtcaccagttatgtatctgggaaattgcatcgggt
ttgctgatgaccacttttccagtggtcaagagtcctttcttacactggcctttgatcaga
tggtctttcaatgacaagtactgcgcacgtatggttggtggcacattggttgtccacgac
agtgataacggattcgcccctatggaaaacaaggccttgaaagttcctggtatcagagat
ttctcttttgctccaagtggtgttaaattacatcctttcagacagaacgacgagccctcc
gtattgttggcttactggactcctgaaactaacaacatgtcctgtaaaggtactattgtc
gaagttcctcgtggtagagtattgaagacggtcaacttggtccaagtttcgaatgtcagt
ctacactggcaaaacaatgccgacttcctatgtttcaacgttgaacgtcacacaaagtct
ggtaaaacattattcagtaatctggaactatgtaaattgactgagaaggatattccagtc
gagaagatcgaatttaaggactgcgtcagagcatttgaatgggaaccaaatggaaacaga
tttgttgccattgcagagcgtgatactggtgacgataatccagctattccaagacacgtt
ataagtttctttgcaccagaagttaaggagaaagaacaagggtcaaatgcttcaacaggt
attaagagatggaagcttgttgtcgatattccagacaaattctctaacacaatttcttgg
tcccctgctggtagatttgtagtcgttgccactttggtcaaaccaaacgttcgtaaatct
gatttcatgttcttcgacgtggatttcgccggtgaaaagaatatcaatgaagcaaaggat
gtcacagcgtctgtgaaggatattgctaaaccagcttatctatcggcaactgacttgaag
tgggatccatccggaagatacttggctgcttggtcgagtgctttgaagcacaagattgaa
aatggttacaagattttcaatgttggtggtgatgtggtcaaggaagaaaccgtatctaat
ttcaagaactttgcatggagaccaagaccagcatctctattgagtaacgcagagaagaag
aaggttagaaagaacttgagagaatggtctgcgcaattcgaagagcaagatgctatggag
gccgactctgctatgagagacttgatcttgagacaacgtgaattgttgaaggaatggcac
gagtacagagccgagtcctccgagaagttgctcaaggacttcggttacaaagcctttgac
gttactccattggatgaagatgatgaacagtacacagtggtggaggaagtaaaggaagag
atcttggaagaaaaagaggaaaaagttcaggacgagtaa

DBGET integrated database retrieval system