KEGG   Sulfurimonas denitrificans: Suden_0016Help
Entry
Suden_0016        CDS       T00298                                 

Definition
phospholipase A1
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Suden_0016
   00565 Ether lipid metabolism
    Suden_0016
   00590 Arachidonic acid metabolism
    Suden_0016
   00591 Linoleic acid metabolism
    Suden_0016
   00592 alpha-Linolenic acid metabolism
    Suden_0016
Enzymes [BR:tdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Suden_0016
    3.1.1.32  phospholipase A1
     Suden_0016
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
22219..23298
Genome map
AA seq 359 aa AA seqDB search
MILRLLVITLLALSLKASVTFDEANLLYARDEYKKAFEAFSLLAKDDADAAYMLAKMYEQ
GEGCEKSEEKAQEWYKASAHIYYEQAKHSPLRNVQKHQKEIFKTLDRVDNNQTQETLRQF
VQSLYNFKAHNANYFLPFSYRYDDNYDEVNGHEAGKVETEFQVSLKYDFAANFFKLREIY
SVAYTQKSFWQSYKESAFIRESNYSPEFFVTFPTSSQDDGGFLKGIRVGVAHQSNGRGAE
YERSWNYVNASLFFQYDILLCELKLWARLPDATDYNPELIDTIGHGYFRIAVPYKKHLFD
MKIMNNFNSKGSIEFNYTHPVSSRDDLFFYMKFFNGYGESLIDYDNHIKKVGIGFSISR
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgattttacgcctccttgtaataactctcttagcactctctttgaaagcttcagttaca
tttgatgaagcaaatttactctatgcaagagatgaatataaaaaagcatttgaagctttt
agcctcttggctaaagatgatgcagatgcagcttacatgttggcaaagatgtatgagcaa
ggagaggggtgcgaaaagagtgaagagaaagctcaagagtggtataaggcatcagctcat
atctactacgaacaagcaaaacatagccccttaagaaatgtacaaaagcatcaaaaagag
atatttaaaacattagacagggttgataataaccaaacgcaagagacgcttagacagttt
gtacaatctctttataattttaaagctcacaatgcaaactattttttaccttttagttat
cgttatgatgataattatgatgaggtaaacggacatgaagcaggtaaagttgagacggaa
tttcaagtaagtttaaaatatgactttgctgcaaattttttcaaacttcgtgagatatat
tctgtggcttatacacaaaaatctttttggcaatcttataaagagtccgcttttattaga
gagtcaaattatagtcctgaattttttgtaacttttcctacatcaagccaagatgatgga
ggattcttaaaagggataagagttggagtggcacaccaatctaacggaagaggcgctgag
tatgagcgttcttggaactatgtaaatgcgagtctcttttttcaatatgacatactactc
tgcgagttaaaactttgggcgaggttacctgatgcaacagattataatccagagttgatt
gataccatagggcatggatatttcaggatagcggttccatataagaaacatctatttgat
atgaaaataatgaataattttaactccaagggttctatagaatttaactatacacaccct
gtatcaagcagggacgatctctttttttatatgaaattttttaatggttatggtgagagt
ttaattgactacgataatcatattaaaaaagtaggaattggctttagtatctcaagatag

DBGET integrated database retrieval system