KEGG   Sulfurimonas denitrificans: Suden_0096Help
Entry
Suden_0096        CDS       T00298                                 

Definition
(GenBank) Pyruvate:acceptor oxidoreductase gamma subunit
  KO
K00172  
pyruvate ferredoxin oxidoreductase gamma subunit [EC:1.2.7.1]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Suden_0096
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Suden_0096
   00020 Citrate cycle (TCA cycle)
    Suden_0096
   00620 Pyruvate metabolism
    Suden_0096
   00640 Propanoate metabolism
    Suden_0096
   00650 Butanoate metabolism
    Suden_0096
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Suden_0096
   00680 Methane metabolism
    Suden_0096
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Suden_0096
Enzymes [BR:tdn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Suden_0096
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
102533..103090
Genome map
AA seq 185 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLADVISTTGKHVQAFAFYGSAKRGAAMTAYNRVDDKVIMN
HEKYMKPDYVFVIDPALVFTSDVTINHKDSTKYIITTHLTTEELIKAQPKLEGKEVYTVD
CITIANETIGRPIPNTPMLGAFMKVSKMYDIEFFKESMQRILGKLPQKIIDANMFAIQRA
YDEVK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattagatggcatagtcgtgctggacaaggcgctgttactggtgctaaaggt
ttagcagatgttatttctacaactggtaagcatgtgcaagcgtttgcattttatggatct
gcaaagcgaggggcagcaatgaccgcttacaaccgtgtagatgataaagtgattatgaat
catgagaagtatatgaaacctgattatgtttttgttattgacccagcacttgtatttaca
agtgatgtgacaataaatcataaagacagtacaaagtacattattacaactcatttaacc
acagaagaactaattaaagctcagcctaaactagaaggcaaagaagtttatacagttgat
tgtataacaattgccaatgaaacaattggtcgtccaattccaaatacaccgatgcttggt
gcatttatgaaagtttctaaaatgtatgatatagaatttttcaaagagagtatgcaaaga
attctagggaagttaccacaaaaaattattgacgcaaatatgtttgctattcagcgcgca
tatgatgaagtaaagtaa

DBGET integrated database retrieval system