KEGG   Sulfurimonas denitrificans: Suden_0096Help
Entry
Suden_0096        CDS       T00298                                 

Gene name
porC, porG
Definition
pyruvate flavodoxin oxidoreductase subunit gamma
Orthology
K00172  
pyruvate ferredoxin oxidoreductase, gamma subunit [EC:1.2.7.1]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Pyruvate:ferredoxin oxidoreductase
Class
Metabolism; Overview; Carbon metabolism [PATH:tdn01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tdn00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:tdn00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:tdn00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:tdn00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:tdn00650]
Metabolism; Energy metabolism; Carbon fixation pathways in prokaryotes [PATH:tdn00720]
Metabolism; Energy metabolism; Methane metabolism [PATH:tdn00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation [PATH:tdn00633]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
102533..103090
Genome map
AA seq 185 aa AA seqDB search
MLEIRWHSRAGQGAVTGAKGLADVISTTGKHVQAFAFYGSAKRGAAMTAYNRVDDKVIMN
HEKYMKPDYVFVIDPALVFTSDVTINHKDSTKYIITTHLTTEELIKAQPKLEGKEVYTVD
CITIANETIGRPIPNTPMLGAFMKVSKMYDIEFFKESMQRILGKLPQKIIDANMFAIQRA
YDEVK
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattagatggcatagtcgtgctggacaaggcgctgttactggtgctaaaggt
ttagcagatgttatttctacaactggtaagcatgtgcaagcgtttgcattttatggatct
gcaaagcgaggggcagcaatgaccgcttacaaccgtgtagatgataaagtgattatgaat
catgagaagtatatgaaacctgattatgtttttgttattgacccagcacttgtatttaca
agtgatgtgacaataaatcataaagacagtacaaagtacattattacaactcatttaacc
acagaagaactaattaaagctcagcctaaactagaaggcaaagaagtttatacagttgat
tgtataacaattgccaatgaaacaattggtcgtccaattccaaatacaccgatgcttggt
gcatttatgaaagtttctaaaatgtatgatatagaatttttcaaagagagtatgcaaaga
attctagggaagttaccacaaaaaattattgacgcaaatatgtttgctattcagcgcgca
tatgatgaagtaaagtaa

DBGET integrated database retrieval system