KEGG   Sulfurimonas denitrificans: Suden_0097Help
Entry
Suden_0097        CDS       T00298                                 

Definition
(GenBank) Pyruvate:acceptor oxidoreductase delta subunit
  KO
K00171  pyruvate ferredoxin oxidoreductase delta subunit [EC:1.2.7.1]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00010  Glycolysis / Gluconeogenesis
tdn00020  Citrate cycle (TCA cycle)
tdn00620  Pyruvate metabolism
tdn00633  Nitrotoluene degradation
tdn00640  Propanoate metabolism
tdn00650  Butanoate metabolism
tdn00680  Methane metabolism
tdn00720  Carbon fixation pathways in prokaryotes
tdn01100  Metabolic pathways
tdn01120  Microbial metabolism in diverse environments
tdn01130  Biosynthesis of antibiotics
tdn01200  Carbon metabolism
Module
tdn_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
tdn_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Suden_0097
   00020 Citrate cycle (TCA cycle)
    Suden_0097
   00620 Pyruvate metabolism
    Suden_0097
   00640 Propanoate metabolism
    Suden_0097
   00650 Butanoate metabolism
    Suden_0097
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Suden_0097
   00680 Methane metabolism
    Suden_0097
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Suden_0097
Enzymes [BR:tdn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Suden_0097
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4 Fer4_21 Fer4_2 Fer4_10 Fer4_9 Fer4_7 Fer4_6 Fer4_8 Fer4_13 Fer4_16 Fer4_4 Fer4_15 Fer4_17 Fer4_3 Fer4_18 Fer4_22
Motif
Other DBs
NCBI-ProteinID: ABB43378
JGI: Tmden0097
UniProt: Q30UF3
Position
103101..103496
Genome map
AA seq 131 aa AA seqDB search
MAKKGWDEFEIGAMLRTFDGKIDDIAGTQQEDRAYSQSSSYTASVADWRLIKPIFNKDYC
IDCQFCWVYCPDVSIISRDKKLIGVDMDHCKGCGICVEVCPTNPKSLLMFPEQADEETEI
ASWPKKDEEEA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaggatgggatgaatttgaaatcggagctatgcttcgcacttttgatgga
aaaatagacgatatcgctggaacacaacaagaagatcgtgcatactcacaaagtagttct
tacactgcaagtgttgctgattggagattaattaaaccaatttttaataaagattactgt
attgattgccagttttgctgggtttattgtccagatgtttcaattatctcaagagataaa
aaactaatcggtgtagatatggatcactgtaaagggtgtggaatatgtgttgaggtttgt
cctacaaacccaaaatcacttctaatgttcccagaacaagccgatgaagagacagaaata
gcttcgtggcctaaaaaagatgaggaggaagcgtaa

DBGET integrated database retrieval system