KEGG   Sulfurimonas denitrificans: Suden_0097Help
Entry
Suden_0097        CDS       T00298                                 

Gene name
porD
Definition
pyruvate flavodoxin oxidoreductase subunit delta
Orthology
K00171  
pyruvate ferredoxin oxidoreductase, delta subunit [EC:1.2.7.1]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Suden_0097 (porD)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Suden_0097 (porD)
   00020 Citrate cycle (TCA cycle)
    Suden_0097 (porD)
   00620 Pyruvate metabolism
    Suden_0097 (porD)
   00640 Propanoate metabolism
    Suden_0097 (porD)
   00650 Butanoate metabolism
    Suden_0097 (porD)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Suden_0097 (porD)
   00680 Methane metabolism
    Suden_0097 (porD)
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Suden_0097 (porD)
Enzymes [BR:tdn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Suden_0097 (porD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
103101..103496
Genome map
AA seq 131 aa AA seqDB search
MAKKGWDEFEIGAMLRTFDGKIDDIAGTQQEDRAYSQSSSYTASVADWRLIKPIFNKDYC
IDCQFCWVYCPDVSIISRDKKLIGVDMDHCKGCGICVEVCPTNPKSLLMFPEQADEETEI
ASWPKKDEEEA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaaaaggatgggatgaatttgaaatcggagctatgcttcgcacttttgatgga
aaaatagacgatatcgctggaacacaacaagaagatcgtgcatactcacaaagtagttct
tacactgcaagtgttgctgattggagattaattaaaccaatttttaataaagattactgt
attgattgccagttttgctgggtttattgtccagatgtttcaattatctcaagagataaa
aaactaatcggtgtagatatggatcactgtaaagggtgtggaatatgtgttgaggtttgt
cctacaaacccaaaatcacttctaatgttcccagaacaagccgatgaagagacagaaata
gcttcgtggcctaaaaaagatgaggaggaagcgtaa

DBGET integrated database retrieval system