KEGG   Sulfurimonas denitrificans: Suden_0099Help
Entry
Suden_0099        CDS       T00298                                 

Definition
pyruvate flavodoxin oxidoreductase subunit beta
Orthology
K00170  
pyruvate ferredoxin oxidoreductase, beta subunit [EC:1.2.7.1]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Nitrotoluene degradation
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Suden_0099
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Suden_0099
   00020 Citrate cycle (TCA cycle)
    Suden_0099
   00620 Pyruvate metabolism
    Suden_0099
   00640 Propanoate metabolism
    Suden_0099
   00650 Butanoate metabolism
    Suden_0099
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Suden_0099
   00680 Methane metabolism
    Suden_0099
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Suden_0099
Enzymes [BR:tdn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Suden_0099
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
104730..105686
Genome map
AA seq 318 aa AA seqDB search
MSEMKNIKNLKEFSTSADRFEGANLLCPGCAHSIIVREVLNATNDDLVLSASTGCLEVCT
AVYPYTSWDASWIHIGFENSSTAVAGAETMYKALKKKGRLKQPERNPKFVSFAGDGASYD
IGFQWISGCMERGHNMMHVVLDNEVYANTGGQRSSSTPIGSSATTSPAGRVSYGEKRNKK
DMMSIMAAHGIPYAAQVAPNKWKDMVKKIQHGLSVEGPVFINAVSPCTTEWKFDPKDTMH
ITDLATDSLVFPLYEIIDGTELNITYRPKNVVPVEEYLAAQGRFKHLFKDEYKYLIKEWQ
ERVDAKWAYLQRREESRV
NT seq 957 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaatgaaaaatataaaaaacttaaaagagttttcaacatcagctgaccgtttt
gagggagccaaccttttatgtccaggttgtgcacactctattattgttcgtgaagtttta
aatgctacaaatgatgacttagttctatctgcatcaacaggatgtctagaggtttgtaca
gcagtttatccatatacttcttgggatgcttcttggattcatattggatttgagaatagt
tcaactgcagttgctggtgctgagacaatgtataaagcactaaagaaaaaagggcgccta
aagcaaccagaacgtaatcctaagtttgtatcttttgcaggtgatggcgcatcttatgat
atcggttttcagtggatttctggatgtatggagcgtggacacaatatgatgcatgtcgtt
cttgataatgaagtttacgcaaatactggaggacaaagatcatcttcaactccaattggc
tcaagtgctactacatctccagctggtcgtgttagttatggggagaaaagaaacaaaaaa
gatatgatgtcaattatggcagctcatggcataccatatgctgcgcaagtagctccaaac
aagtggaaagatatggttaagaagattcaacatggtctctcagtagagggtcctgtattt
attaatgcagtttctccatgtacaacagagtggaaatttgatccaaaagatacaatgcac
attacagatttagcaacagattctttagtgtttcctctttatgagattattgacggaaca
gagttaaatattacatatagacctaaaaatgttgttcctgtagaggagtatttagctgct
caagggcgttttaaacaccttttcaaagatgagtacaaatacttaataaaagagtggcaa
gagcgcgtagatgctaaatgggcatatttacaacgccgtgaagagtcacgcgtataa

DBGET integrated database retrieval system