KEGG   Sulfurimonas denitrificans: Suden_0269Help
Entry
Suden_0269        CDS       T00298                                 

Definition
(GenBank) methyl-accepting chemotaxis sensory transducer
  KO
K03406  methyl-accepting chemotaxis protein
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn02020  Two-component system
tdn02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Suden_0269
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Suden_0269
Bacterial motility proteins [BR:tdn02035]
 Flagellar system
  Chemotaxis proteins
   MCPs
    Suden_0269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MCPsignal dCache_3
Motif
Other DBs
NCBI-ProteinID: ABB43550
JGI: Tmden0269
UniProt: Q30TY1
Position
282619..284610
Genome map
AA seq 663 aa AA seqDB search
MTIGKRVTILVIGISFALLVSSFFVLNYFKAAIVQNVYSDMRSTLTAKIEDRMNAKFDIG
VTNAVAMANNSDIIASLKNNDRALAAKTLESIGDTYKEQTDFKNIKIHIHDKDVKSFLRN
WQVDKFGDDLSSFRHTINKVKESKKSMAAIEVGRNGLTIRGLVPVIADNSYLGSLEFMQG
FESVVKQFLKEKEYLLVLMDNKLLNVADLSNTKNRISNYTLSQKTIDDKFLLEAKTIDME
AVLRDGYFVDKNYFYTYTYIKDFENKPIGIYLLAKDRPSIEKAIDGASSIINSALLLVAS
LIFIITIAILVTIKKIVLNPLNVFQEGLLEFFKYLNKQSNKAELIAIDTNDEIGKMAKIV
NENILKTKENIELDQDLINDVKRVVMEVERGNLNQEVTKSTQNQALFELKDSLNKMLYSL
KNSVAKDINSLVAVLDSFKNSDFRATLENDEAKVSQAINSIGQTIRDMLRDSNTNADELT
RTSVSLIERMQTLAEGSYKQASMLKDISKTMELANSSVVEVSQMTKAVVIKSTDIKSVVN
VISEIADQTNLLALNAAIEAARAGEHGRGFAVVADEVRKLAENTQRSLDDININIESLTQ
AVVDIGTTIEEQVKDINMATDSIKVIDKTTQEHAIHTKEIENIAIKLDEMSKKTLQSIST
KKF
NT seq 1992 nt NT seq  +upstreamnt  +downstreamnt
atgacaataggaaaaagagttactatacttgttataggtatatcatttgcactcttggtt
agtagcttctttgtgcttaattattttaaggctgcgattgtacaaaatgtttatagtgat
atgagaagtacacttacggctaagatagaagatagaatgaatgctaagtttgatataggc
gtgactaatgcagttgccatggcgaataactctgacataatcgcttcacttaagaataat
gacagagctttggctgcaaaaacactcgaatccattggagacacatataaagaacagaca
gattttaaaaatattaaaatccatattcatgacaaagatgtaaagtcttttttaagaaat
tggcaagttgataagttcggcgatgatttatctagctttagacacacaatcaataaggtc
aaagagagtaaaaagtcgatggcagcgattgaagttggtagaaacgggcttactattaga
ggattggttcctgttatagctgataatagctatttaggctcattagagtttatgcagggt
tttgaatctgtagtaaagcagtttttaaaagagaaagagtacctcttagtgcttatggat
aacaaactgctaaatgttgcagacctctcaaatacaaaaaacagaatctctaactacact
cttagccaaaaaacaattgatgataagtttctattagaagctaaaactattgatatggaa
gctgttctcagagatggatattttgttgataagaactatttttatacctacacatatata
aaagattttgaaaataaacctatcggaatttatcttcttgcaaaagatagacctagtata
gaaaaagcgatagatggcgcaagcagtattataaacagcgcacttttgctagttgcttct
cttatctttatcataacaattgctatattagttactatcaaaaaaatagtacttaatcct
ttaaatgtttttcaagaagggctgttggaattttttaaatacctaaacaaacagagcaat
aaagcggaactcatagcgatagatacaaatgatgaaatcggtaagatggctaagattgta
aatgaaaatattctaaaaacaaaagagaatattgagctagaccaagatcttatcaatgat
gtaaaaagagtagttatggaagtagagagaggaaatcttaatcaagaagtaactaaatca
actcaaaatcaagctctttttgaattaaaagatagtttaaataaaatgctctactcttta
aaaaacagtgttgcaaaagatataaattcacttgtggctgttttggatagttttaaaaat
tctgattttagagctactcttgagaatgatgaggcaaaagtgtctcaagcaataaacagt
attgggcaaaccataagagatatgctaagagattcaaatacaaatgcggatgagcttaca
cgaacttcagtgagtcttattgagagaatgcagacattagcagaaggctcatataaacaa
gcatcaatgctcaaagatatctctaaaacaatggagttagcaaatagttctgttgttgaa
gtttcacagatgacaaaagctgttgtaataaaatcaaccgatataaaatcagtggtaaat
gtaatatctgaaattgcagaccagacaaatctcctagcactaaacgctgctattgaagct
gcacgtgcaggtgaacatgggcgtggatttgctgttgttgctgatgaggttagaaaactt
gcagaaaatacacaacgaagccttgatgatataaatataaacatagaatctcttactcag
gcagttgttgatataggaactacaatagaggagcaggttaaagatataaatatggccaca
gactctattaaagttatagataaaacaactcaagagcacgctatacatacaaaagagatt
gaaaatattgcaattaaactagatgagatgtctaaaaaaacacttcaaagtataagtact
aaaaagttctaa

DBGET integrated database retrieval system