KEGG   Sulfurimonas denitrificans: Suden_0332Help
Entry
Suden_0332        CDS       T00298                                 

Definition
(GenBank) UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase
  KO
K01928  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00300  Lysine biosynthesis
tdn00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Suden_0332
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Suden_0332
Enzymes [BR:tdn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Suden_0332
Peptidoglycan biosynthesis and degradation proteins [BR:tdn01011]
 Precursor biosynthesis
  Amino acid ligase
   Suden_0332
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mur_ligase_M Mur_ligase_C ADH_zinc_N DapB_N CbiA
Motif
Other DBs
NCBI-ProteinID: ABB43613
JGI: Tmden0332
UniProt: Q30TR8
Position
332164..333465
Genome map
AA seq 433 aa AA seqDB search
MKIEIPDEAFRYITENSQECDADTAFVLTPQNEKYLQNAKDNGAHSIINIKDVAKLFGIE
KIKIVGITGTNGKTTTASAIYSFLLDLGYRVAMQGTRGFFMNDRVIEEKTLTTPSLLNTY
KHIYQAVSEKCDFFIMEVSSHAIVQKRVEGLNFELKILTNITQDHLDFHKTLGEYIAVKN
SFFQDDGRKLINKDETKSSFNFKNTFTYGIENSATYRLIAYSLNNASSGIIQHFSEVVPF
TSSLHGFFNLYNLMAAIAATHLLSGKKLEEVTAVVDNFAGVSGRMEQVSESPNVIVDFAH
TPDGIQQVLNALKEKELLVVFGAGGDRDRTKRPLMGRVAASLAKKLYITSDNPRTEDPQD
IVNDILEGIQDKSIVQVELNRRKAIENALSEQKENEVVVILGKGDETYQIIYDQKFPFDD
REVVREILKNKII
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaattgagataccagatgaagcttttagatatataactgaaaactcacaagagtgt
gatgcagatacagcttttgttttaactccacaaaatgaaaaatatcttcaaaatgcaaaa
gataatggcgcacactcaatcataaatatcaaagatgtagcaaagttatttggtattgag
aagataaaaattgtaggtattacaggaacaaacggcaaaaccacgacggctagtgcgata
tactcgtttttgctcgatttaggttacagagttgctatgcaaggaactcgtggttttttt
atgaacgacagagtgatagaagaaaaaactttaacaacaccatcactcttaaatacatat
aaacatatttaccaagctgtgagtgaaaagtgtgatttttttattatggaagtaagttct
catgctatcgtacaaaagagagtagaaggtcttaactttgaacttaaaattcttacaaac
attacacaagatcatcttgatttccataaaacattaggcgaatatatcgcagtaaaaaac
agcttttttcaagatgatggtagaaaactcataaacaaagatgagacaaaatcatcattt
aattttaaaaatacctttacttacggtatagaaaattcagcaacttatagactaatagca
tattcgctaaataatgcatcgagtggaattattcaacattttagcgaagtagttcctttt
acatcttcattgcatggcttcttcaatctatacaatcttatggcagcaattgcagcaaca
catctactaagtggtaaaaaattagaagaagtaactgcagtagtagataatttcgctggt
gttagtggaagaatggaacaagttagtgagagcccaaatgttatagttgattttgcacat
actccagatgggatacaacaagtcttaaatgcattaaaagagaaagaacttttagtagtt
tttggagctggcggagatcgagatagaacaaaaagacctttgatgggcagagttgcggca
agtttggcaaagaagttgtacatcacaagcgataatccaagaactgaagatcctcaagat
attgtaaatgatattttagagggaatccaagataaaagtattgttcaagttgagctaaat
agaagaaaagcgatagagaacgctttgagtgaacaaaaagagaatgaagttgttgttatc
cttggcaaaggcgatgaaacttatcagattatatatgaccaaaagtttcctttcgatgat
agagaagtggtaagagagatactcaaaaataaaataatttaa

DBGET integrated database retrieval system