KEGG   Sulfurimonas denitrificans: Suden_0385Help
Entry
Suden_0385        CDS       T00298                                 

Definition
delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Suden_0385
Enzymes [BR:tdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Suden_0385
Exosome [BR:tdn04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Suden_0385
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
386282..387253
Genome map
AA seq 323 aa AA seqDB search
MFQRFRRTRLNSHLRSLVRETNVSVDDFIYPLFVRSGEGIKTEVSSMPGVFQMSIDEVLK
ECEDLKKLGLYSIILFGIPDVKDSIGSDSLCEHGIIAKAIRAIKKAHPEMFVVTDLCFCE
YTDHGHCGIIDEKKQTVNNDATLEISAQQAIVHAKAGADMIAPSGMMDGIIITLREALDG
AGYENLPIMSYSTKFASGYYGPFREVAESTPSFGDRASYQMDPANRREAIAESISDEAQG
ADILMVKPALAYLDIVREIKDATSLPMAVYNVSGEYAMIKFAGMQGLIDYDRVVMETMVS
FKRAGADIIISYHAKEVARMLQK
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaagatttcgcagaactcgcttaaatagtcatcttcgttcactagtgcgtgag
acaaatgtaagtgtagatgattttatttatccgctttttgtgcgctctggggagggcata
aaaacagaagtctcatcaatgccgggggtgtttcaaatgagtatagatgaggttttaaaa
gagtgcgaagatcttaaaaaactaggactttactcaatcattctctttggaatacctgat
gtaaaagactccatagggtctgattctttatgcgaacatgggattattgcaaaggctata
cgtgccataaaaaaggctcatcctgagatgtttgtagtaacggacttatgtttttgtgaa
tacacagatcatggacactgcggaatcattgatgaaaaaaaacaaacagtaaataatgat
gcaactcttgaaatatctgctcaacaagcgatagttcatgcaaaagctggagcagatatg
atagcaccatcaggtatgatggatggcataataataacacttagagaagcacttgatgga
gcagggtatgaaaatctccctatcatgagctactctacaaagtttgcttcaggatattat
ggtccatttcgtgaggtagcagaatcaaccccaagttttggagaccgtgcttcatatcag
atggacccagcaaatagaagagaagctattgctgagagtatctctgatgaggctcaaggg
gcagatattttgatggtaaaaccagctcttgcatacttggatatagtaagagagataaaa
gatgcaacatcgcttcctatggctgtttataacgtaagtggtgagtatgccatgataaaa
tttgcaggtatgcagggattaattgattatgacagagttgtgatggagacaatggttagt
tttaagagagcaggtgcggatattataatctcttatcatgcaaaagaggttgcaaggatg
ttacaaaagtaa

DBGET integrated database retrieval system