KEGG   Sulfurimonas denitrificans: Suden_0423Help
Entry
Suden_0423        CDS       T00298                                 

Definition
(GenBank) Uroporphyrinogen III synthase HEM4
  KO
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Suden_0423
Enzymes [BR:tdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Suden_0423
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
424115..424753
Genome map
AA seq 212 aa AA seqDB search
MSKNIYLFATSKSKHARSIKSLDVRYLKPEIDFSKYDYLIVTSKQTVKALEQYNKEEFIN
IAALCVSDKTADSYRAIGGKILASGDGYGDNLIKNIRELPHVTKWLYLRAELIASSFVQI
AKEEGYEIDEKILYISECSKEILEVRVEDDSTLIFTSPSSIECFLKNNTIHPNAKVIVIG
TTTAAYLPKDIKYVISQNTSIESCIELAIEAK
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaaaatatctatctttttgctacttcaaagagtaaacatgcaagaagtataaaa
tctttagatgttagatacttaaagccagaaattgacttttcaaaatatgattacctcatt
gtcacatcaaaacagactgtaaaagcgcttgaacagtacaacaaagaggagtttataaac
attgctgctctttgcgtctctgataaaacagcagattcgtacagggcaatcggaggcaag
attttggcaagcggagatggctatggtgataatcttataaaaaacataagagagttaccc
catgttactaaatggctctatcttagagcagaacttatagcttcaagtttcgttcaaata
gcaaaagaggaaggatatgagattgatgagaagatactctatataagcgagtgctcaaaa
gagatactagaggtaagagtagaagatgattcaacccttatttttacatcaccatcctca
attgagtgttttttaaaaaacaatacaatccatccaaatgcaaaagttatagtaattggt
acaacgacagctgcttatttgccaaaagatataaagtatgtaattagtcaaaacacgtct
atagagagctgtattgagcttgcaatagaagcaaaataa

DBGET integrated database retrieval system