KEGG   Sulfurimonas denitrificans: Suden_0549Help
Entry
Suden_0549        CDS       T00298                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Suden_0549
   01230 Biosynthesis of amino acids
    Suden_0549
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Suden_0549
   00030 Pentose phosphate pathway
    Suden_0549
   00051 Fructose and mannose metabolism
    Suden_0549
   00052 Galactose metabolism
    Suden_0549
  Energy metabolism
   00680 Methane metabolism
    Suden_0549
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Suden_0549
Enzymes [BR:tdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Suden_0549
Protein phosphatases and associated proteins [BR:tdn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Suden_0549
Messenger RNA biogenesis [BR:tdn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Suden_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(552751..553710)
Genome map
AA seq 319 aa AA seqDB search
MKNIAILSSGGDVSGMNPAIKHFVEYALHNGLTPYFVYNGFEGLIDNKITKASHSDVAGI
INRGGTILGSSRSKRFMLKNYREVAKKNLDALDIDMLIVLGGDGSFRGMDIFYKEHGVKF
CGIPSTIDNDINGTIYCLGVDTALNVIKDSIDNIRDTASSFSRAFVIETMGRDCGYLALV
SSLCSGAELCLIPEVEYNLSSYEDSFKEQIKNGRKYFIVIVSEGIKDNSKEIAEWLEQKV
GIESRVTVLGHTQRGGTPSIYDRLMAYKFVNHAIDALLGDINSSVVCYSKTGFIHKDIDE
ITSQKYMLDPELLSYLKKF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagctattttatcctctggcggtgatgtaagtggaatgaatcccgcaatt
aaacactttgttgagtatgcattacacaatggactcactccttactttgtttacaacggt
tttgaggggctaattgataacaaaataacaaaagcatctcatagcgatgttgctgggatt
ataaatcgtggcggtacaattttgggctcttcaagaagtaaaagatttatgctcaagaac
tacagagaagtggcgaagaaaaatcttgacgctttagatattgacatgttaatcgtttta
ggcggagatggctcttttaggggaatggatatattttataaagagcatggtgtaaagttt
tgtggtatcccatcaaccatagataacgacataaacggcactatatactgccttggagtg
gacacagctctaaatgtaatcaaagactcaattgacaacatcagagatacagcctcctct
ttttcaagagcatttgtaatagagactatggggcgagattgcggttatttagctcttgta
tcatctttatgtagcggagcggaactctgccttataccagaagtagaatataatctaagt
agttatgaagatagctttaaagagcagataaaaaacggaagaaaatattttatcgttata
gtttcagagggtattaaagataactcaaaagagattgcagagtggcttgagcaaaaagtt
ggcatagagtcaagagtaactgttttagggcatactcaaagaggcggaactcctagcata
tatgacagacttatggcttacaagtttgtaaatcacgcaattgatgcccttcttggcgat
ataaattcaagtgttgtctgctatagtaaaactgggtttattcataaagatatagatgaa
ataacaagccaaaagtacatgttagacccagagcttcttagttatctaaaaaagttttaa

DBGET integrated database retrieval system