KEGG   Sulfurimonas denitrificans: Suden_0549Help
Entry
Suden_0549        CDS       T00298                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00010  Glycolysis / Gluconeogenesis
tdn00030  Pentose phosphate pathway
tdn00051  Fructose and mannose metabolism
tdn00052  Galactose metabolism
tdn00680  Methane metabolism
tdn01100  Metabolic pathways
tdn01110  Biosynthesis of secondary metabolites
tdn01120  Microbial metabolism in diverse environments
tdn01130  Biosynthesis of antibiotics
tdn01200  Carbon metabolism
tdn01230  Biosynthesis of amino acids
tdn03018  RNA degradation
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Suden_0549
   00030 Pentose phosphate pathway
    Suden_0549
   00051 Fructose and mannose metabolism
    Suden_0549
   00052 Galactose metabolism
    Suden_0549
  Energy metabolism
   00680 Methane metabolism
    Suden_0549
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Suden_0549
Enzymes [BR:tdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Suden_0549
Protein phosphatases and associated proteins [BR:tdn01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Suden_0549
Messenger RNA biogenesis [BR:tdn03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     Suden_0549
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: ABB43828
JGI: Tmden0549
UniProt: Q30T53
Position
complement(552751..553710)
Genome map
AA seq 319 aa AA seqDB search
MKNIAILSSGGDVSGMNPAIKHFVEYALHNGLTPYFVYNGFEGLIDNKITKASHSDVAGI
INRGGTILGSSRSKRFMLKNYREVAKKNLDALDIDMLIVLGGDGSFRGMDIFYKEHGVKF
CGIPSTIDNDINGTIYCLGVDTALNVIKDSIDNIRDTASSFSRAFVIETMGRDCGYLALV
SSLCSGAELCLIPEVEYNLSSYEDSFKEQIKNGRKYFIVIVSEGIKDNSKEIAEWLEQKV
GIESRVTVLGHTQRGGTPSIYDRLMAYKFVNHAIDALLGDINSSVVCYSKTGFIHKDIDE
ITSQKYMLDPELLSYLKKF
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaatatagctattttatcctctggcggtgatgtaagtggaatgaatcccgcaatt
aaacactttgttgagtatgcattacacaatggactcactccttactttgtttacaacggt
tttgaggggctaattgataacaaaataacaaaagcatctcatagcgatgttgctgggatt
ataaatcgtggcggtacaattttgggctcttcaagaagtaaaagatttatgctcaagaac
tacagagaagtggcgaagaaaaatcttgacgctttagatattgacatgttaatcgtttta
ggcggagatggctcttttaggggaatggatatattttataaagagcatggtgtaaagttt
tgtggtatcccatcaaccatagataacgacataaacggcactatatactgccttggagtg
gacacagctctaaatgtaatcaaagactcaattgacaacatcagagatacagcctcctct
ttttcaagagcatttgtaatagagactatggggcgagattgcggttatttagctcttgta
tcatctttatgtagcggagcggaactctgccttataccagaagtagaatataatctaagt
agttatgaagatagctttaaagagcagataaaaaacggaagaaaatattttatcgttata
gtttcagagggtattaaagataactcaaaagagattgcagagtggcttgagcaaaaagtt
ggcatagagtcaagagtaactgttttagggcatactcaaagaggcggaactcctagcata
tatgacagacttatggcttacaagtttgtaaatcacgcaattgatgcccttcttggcgat
ataaattcaagtgttgtctgctatagtaaaactgggtttattcataaagatatagatgaa
ataacaagccaaaagtacatgttagacccagagcttcttagttatctaaaaaagttttaa

DBGET integrated database retrieval system