KEGG   Sulfurimonas denitrificans: Suden_0556Help
Entry
Suden_0556        CDS       T00298                                 

Definition
(GenBank) UDP-N-acetylglucosamine 1-carboxyvinyltransferase
  KO
K00790  UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00520  Amino sugar and nucleotide sugar metabolism
tdn00550  Peptidoglycan biosynthesis
tdn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Suden_0556
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Suden_0556
Enzymes [BR:tdn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.7  UDP-N-acetylglucosamine 1-carboxyvinyltransferase
     Suden_0556
Peptidoglycan biosynthesis and degradation proteins [BR:tdn01011]
 Precursor biosynthesis
  Transferase/Dehydrogenase
   Suden_0556
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: EPSP_synthase ATP_synth_reg
Motif
Other DBs
NCBI-ProteinID: ABB43835
JGI: Tmden0556
UniProt: Q30T46
Position
complement(561437..562705)
Genome map
AA seq 422 aa AA seqDB search
MDYLQIKKSPKLHGEIKISGAKNAALPLIAMSILAKNIVTIKNLPHVADIKTLLKLLSNL
GAECSSSWENYSTTINTSTLNQTKATYDIVKTMRASILVLGPILARFGHCEVSLPGGCAI
GQRPIDLHLKALEQMGAVINIEAGYIHAIAPDGLKGCNIIFDKITVTGTANIVMAAALAK
GVTTITNAAREPEVVQLCEILNASGVKIEGIETAVLTIHGTGGELLEIAPFSVIPDRIEA
GTYLCAGAITKSELTLKGANAKHLGAVLSKLEEMGSKFTITDDSITIHPSKIIKHVKIVT
QEYPAFPTDMQAQFLALATQADGTSIIEERLFENRFMHVSELQRMGADISLNGNVATVNG
HSKLSGTDVMATDLRASSALVLAGLVADGITDVHRIYHLDRGYDSLEKKLQNVGADISRL
KE
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atggattacttacaaattaaaaaatctcctaaactacatggcgaaataaaaatttctggt
gcaaaaaatgcagctctgccactaattgccatgagcatacttgctaagaacatagttact
ataaaaaatcttccacatgtagcagatattaaaactcttttaaaactcttatcaaacttg
ggtgcagagtgttcatcctcatgggaaaattattccacaaccataaatacatcaactcta
aatcagacaaaagcgacttatgatattgtaaaaactatgcgcgcttctatcttagtcctt
ggtccaatattagcgagatttggtcactgtgaagtatctcttcctggtggatgtgccatc
ggacaacgcccaattgatttgcatttaaaagctttagagcagatgggtgctgtaataaat
atagaagctggttatatccatgccattgcaccagatgggctaaagggttgcaatattatt
tttgacaagattacagtaacaggaactgcaaatatcgttatggcagcagctctagccaag
ggagtaacaacaataacaaatgctgcaagagagcctgaagtggttcaactttgtgaaata
ctaaatgctagtggagtaaagattgaggggattgaaactgcggttttaactattcatgga
actggtggagaacttctagagattgcaccttttagtgttataccagatcgaattgaggct
ggaacttatctatgtgctggcgctattacaaagtcagagcttaccctaaaaggagctaat
gcaaaacatttaggcgctgttttatcaaagcttgaagagatgggaagcaaatttactata
acagatgactctattactatccacccatcgaaaatcatcaaacatgtaaaaattgtaacg
caagagtatcctgcttttcctaccgatatgcaagctcagtttttagcacttgcaacacaa
gcagatggaacttctataatcgaggagagactctttgagaacagatttatgcatgttagt
gaacttcaaagaatgggtgcagatatctctttaaatggaaatgtagcaacagtaaacggc
cactcaaaattgagtggaactgatgtgatggcaacagatttaagagcttcaagtgctttg
gttttagctggtttagtcgcagatggaattactgatgttcaccgcatttaccacctagat
agaggttatgactctttagagaaaaagctgcaaaatgttggtgcagatatttcaagacta
aaagagtag

DBGET integrated database retrieval system