KEGG   Sulfurimonas denitrificans: Suden_0570Help
Entry
Suden_0570        CDS       T00298                                 

Definition
ATP-dependent citrate lyase subunit beta (EC:2.3.3.8)
Orthology
K15231  
ATP-citrate lyase beta-subunit [EC:2.3.3.8]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Citrate cycle (TCA cycle)
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Suden_0570
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Suden_0570
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Suden_0570
Enzymes [BR:tdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.8  ATP citrate synthase
     Suden_0570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
572262..573596
Genome map
AA seq 444 aa AA seqDB search
MAQKAIREFDAKSILAKHWDKYFPNFTYAYETVMVQNGSELKKAAKEKTWLKDKKLVAKP
DMLFGKRGKNGLVLFRDSKPGDVSLTKASSWIDEKSGEKQSVYFSFDGDTPSGEAKVDML
THFIVEPFTPHSQEEEYYISATCVGDDDVLYMSAEGGMEVEENWDKVTEVAFPITATEEE
IEKKIKASIPKDVAAKDKEAFADFAIGFFRAYRELNFAYLEINPFVLQGKKVELLDMVAK
LDDTAGFMMREEWGDVDFPTSFGMEEKSPEVLAIEDADSKSGASLKLTILKPEARVWTMV
AGGGASVVYADTIADLAGIEDLANYGEYSGGPTTSETKFYAETILDLMTRDKDLKGRDKV
LIIGGAIANFTDVAKTFTGIIQAFELYADKMKQVGIKIYVRRGGPNYEKGLKDIKEAADR
LGLYIEVYGPETHVTDIVRMALAK
NT seq 1335 nt NT seq  +upstreamnt  +downstreamnt
atggctcaaaaggcgattagagaatttgacgcaaagtcaattttggctaagcattgggat
aaatattttccaaattttacttacgcatacgaaacggttatggttcaaaatggatcagag
cttaaaaaagctgcaaaagaaaaaacatggttaaaagataaaaaattagttgctaaacca
gatatgctatttggtaaaagaggaaaaaatggcttagttctttttagagactctaagcct
ggagatgtatctttaactaaagcatcatcttggattgatgaaaaatcaggcgaaaaacag
tctgtttatttttcatttgatggcgacactcctagcggcgaagcaaaagttgatatgttg
actcactttatcgttgagccatttactccgcactctcaagaagaagagtactatatttct
gctacatgtgttggcgatgatgatgttttatacatgtcagctgagggtggaatggaagtt
gaagagaattgggacaaagttacagaagtggctttcccaattactgcaacagaagaagaa
attgagaaaaaaatcaaagcaagtattccaaaagatgtggctgctaaagataaagaggca
tttgcagattttgcaataggcttttttagagcatatagagagttaaattttgcatattta
gagataaatccatttgttcttcaaggtaaaaaagttgaattactagatatggttgcaaaa
cttgatgatactgctgggtttatgatgagagaagagtggggtgatgtagatttcccaact
tcttttggcatggaagagaaatctcctgaagttttagctatagaagatgctgatagtaaa
tcaggtgcttcgctaaaactaaccatattaaaaccagaagcaagagtttggactatggtt
gcaggtggtggtgcttcagttgtttatgctgacactatcgctgatttggctggaattgaa
gaccttgctaactatggcgaatactcaggtgggccaactacaagtgagacaaaattttat
gctgagactattttagatcttatgacaagagacaaagatcttaaaggcagagataaagtg
ttgattattggtggtgcaattgcaaattttacggatgttgctaaaacatttacgggtatt
attcaagcatttgagctttacgctgataaaatgaaacaagttggtattaagatttatgtt
agacgcggtggaccaaattatgaaaaaggtctcaaagatattaaagaagcagcagataga
cttggtctttatatagaagtttatggaccagaaacacatgttactgacattgtgcgtatg
gcactagcaaagtaa

DBGET integrated database retrieval system