KEGG   Sulfurimonas denitrificans: Suden_0623Help
Entry
Suden_0623        CDS       T00298                                 

Definition
(GenBank) Phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00010  Glycolysis / Gluconeogenesis
tdn00030  Pentose phosphate pathway
tdn00051  Fructose and mannose metabolism
tdn00052  Galactose metabolism
tdn00230  Purine metabolism
tdn00500  Starch and sucrose metabolism
tdn00520  Amino sugar and nucleotide sugar metabolism
tdn00521  Streptomycin biosynthesis
tdn01100  Metabolic pathways
tdn01110  Biosynthesis of secondary metabolites
tdn01120  Microbial metabolism in diverse environments
tdn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Suden_0623
   00030 Pentose phosphate pathway
    Suden_0623
   00051 Fructose and mannose metabolism
    Suden_0623
   00052 Galactose metabolism
    Suden_0623
   00500 Starch and sucrose metabolism
    Suden_0623
   00520 Amino sugar and nucleotide sugar metabolism
    Suden_0623
  Nucleotide metabolism
   00230 Purine metabolism
    Suden_0623
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Suden_0623
Enzymes [BR:tdn01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Suden_0623
    5.4.2.8  phosphomannomutase
     Suden_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABB43902
JGI: Tmden0623
UniProt: Q30SX9
Position
636089..637447
Genome map
AA seq 452 aa AA seqDB search
MSIYREYDIRGIYEQELNEQSVTRIGYALASKIKGEYVAVGYDARDHSPILFEYLVHGLN
AGGKKVLDIGMVPTPVNYFCNYNEFDGILASASVMITGSHNPSEYNGFKITIDKAPFFGE
DIYALGRECETIKSIPKVKREVTKIDALSRYVDFLVSEFQHLKGMPTRIVYDCGNGVAGI
VTERIFSALELHVKGLYVNPDGTFPNHHPDPSDEHNLEDIKKLLATEGDIAFAYDGDADR
IAVLTHKNNIKGDMMALLYSLKMDKPTVVGEVKCSQVMYDELEKRGAKAIMYKTGHSNLK
VKMQEINADLACEVSGHVFFKNRYFGYDDAIYATLRMLELVHDGIDLDAELAKLPQVFST
EEIKVKTTESEKFKIIDRVKELLKTPPAHFPKIKNIIDVDGVRINFEHGWGLVRASNTTP
VLVTRFESTSQAEAKLYEDSMNKLILEAKNSL
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
gtgagcatttacagagagtatgatattagaggaatttatgagcaagagttaaatgagcag
agcgttactcgcattgggtacgctttagcttcaaaaatcaaaggtgagtatgttgctgtt
ggctacgacgcaagagaccactctcctattctttttgagtatcttgttcacgggcttaat
gctggtgggaaaaaagttttagatataggaatggttccaactccagttaactacttctgc
aactacaacgaatttgatggcatcttagcttctgcttcagtgatgattacaggttcacac
aacccaagcgaatataacggctttaaaataacaatagacaaagctcctttttttggtgaa
gatatttatgcactaggacgtgagtgcgaaactattaaaagcataccaaaagtaaaaaga
gaagttacaaaaatagatgcactatctcgttatgttgattttttagttagcgagtttcaa
catctaaaaggtatgccgactcgcatagtttatgattgcggaaacggcgttgctggaatt
gttactgagagaatcttctctgcgttagagttacatgtaaaaggtctttatgtaaatcca
gatggaacttttccaaaccaccatccagacccttcagatgagcataacttagaggatatt
aaaaagcttctagcaactgagggcgatatcgcttttgcttatgatggggatgccgaccgc
atagctgttttaactcataaaaacaatattaagggcgatatgatggctcttttgtactct
ttgaagatggataaacctacagttgttggagaggtaaaatgttctcaagttatgtatgat
gagttagagaagcgaggtgcaaaagctatcatgtacaaaactggacactcaaatttaaaa
gtaaaaatgcaagagataaatgccgaccttgcgtgtgaagtaagcggacatgtatttttc
aaaaatcgctactttggttatgatgatgctatttatgcaactcttcgtatgttagagctt
gttcatgatggaattgacttagatgcagaacttgcaaaacttcctcaagttttctcaact
gaagagataaaagtaaaaaccacagagagtgaaaaatttaaaatcatagatagagtaaaa
gagcttttaaaaactcctccagcacattttccaaaaattaaaaatattatagatgttgat
ggcgttcgaataaactttgaacatggatggggacttgtacgtgcttcaaacacaactcct
gtgttggtaactcgttttgaatcaacttcacaagcagaagcaaaactctatgaagactct
atgaacaagcttatcttagaggcaaaaaactctctttaa

DBGET integrated database retrieval system