KEGG   Sulfurimonas denitrificans: Suden_0646Help
Entry
Suden_0646        CDS       T00298                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Suden_0646
Enzymes [BR:tdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Suden_0646
Transfer RNA biogenesis [BR:tdn03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Suden_0646
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
658673..659428
Genome map
AA seq 251 aa AA seqDB search
MIHIIDIETVKKIAQEAGDAIMKIYTKDFHIEYKDDSSPLTEADIKANEIICSSLFKLYP
NIPILSEENKIPEYKTRKNWEYYWCIDPIDGTKEFIKKNGEFTVNIALIHKNSPILGVVY
APALNGMYWALQGKGAFFNGEKLPLKINSNKKEKLLVVVSKSHLSPQTQVFIDNLDTKEV
EQLSVGSSLKLCMVAEGSADIYPRLAPTTEWDTAAADAIVRESGKMSYQFDTEIPLVYNK
ENLLNPWFVVK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgattcatataattgatattgagactgtaaaaaagatagcgcaagaagctggtgatgcc
atcatgaaaatttatacaaaagattttcatatagaatataaagatgactcctctcccctc
actgaggcagatataaaagcaaatgaaatcatctgtagctctctgtttaaactatatcca
aacatcccaattctctcagaagagaataaaatcccagaatataaaactagaaaaaattgg
gaatattactggtgcattgacccgattgatggaactaaagagttcataaagaaaaatggt
gagttcactgtaaatattgcccttatccacaaaaactctcccatccttggagttgtatat
gctcctgcattaaatggcatgtactgggctttgcaaggtaaaggcgcattttttaatgga
gaaaaactgcctttaaaaataaattctaataaaaaagagaagctcttagtagtagtttca
aaatctcatctatcgcctcaaactcaagtatttatagataatcttgatacaaaagaggta
gaacaactctcggtcggaagttcactaaaactttgtatggtagcagagggaagtgctgac
atctacccacgattagctccaactacagagtgggatactgccgctgctgatgcaatagtt
agagagagtggaaaaatgagttatcagtttgataccgagataccgctagtttataataaa
gaaaatttattaaatccttggtttgtggtaaagtaa

DBGET integrated database retrieval system