KEGG   Sulfurimonas denitrificans: Suden_0688Help
Entry
Suden_0688        CDS       T00298                                 

Definition
7,8-dihydro-6-hydroxymethylpterin-pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:tdn00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
699580..700065
Genome map
AA seq 161 aa AA seqDB search
MFIERKLNDSLTIYKNLRFYKKEQKSFHRYRVTIGIGGNVGDVKRRFAHLETYFKRDKRV
EFLQKSLILKNPPFGFMNQDDFFNSIIILKTSMQPMLFLNYLMRVEKKFGRKRSFANAPR
TLDLDIIFFDERVVKKERLSIPHPEYSKRVSVLIPLKGLKK
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgtttatagagcgtaaattaaacgatagtttgactatctataaaaatttacgtttttat
aaaaaagagcaaaaaagcttccatcgttatagagttactatcggtataggtggaaatgtt
ggcgatgtcaaaagaagatttgcacatcttgaaacatattttaagagagataaaagagtt
gagtttttgcaaaaatcgttgattttaaaaaatcctccttttggttttatgaatcaggat
gatttttttaattcaataattatattaaaaacgagtatgcaacctatgctatttttaaat
tatttaatgagagttgagaagaaatttggacgtaaaagaagttttgcaaacgctccacga
acacttgatttggatattatatttttcgatgagagagttgttaaaaaagagagactttcc
attccgcatcctgagtattcaaagagagtcagtgtgctaattccacttaaaggtttaaaa
aaatga

DBGET integrated database retrieval system