KEGG   Sulfurimonas denitrificans: Suden_0742Help
Entry
Suden_0742        CDS       T00298                                 

Definition
(GenBank) Tryptophan synthase, beta chain
  KO
K06001  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Suden_0742
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Suden_0742
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Suden_0742
Enzymes [BR:tdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Suden_0742
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(766108..767319)
Genome map
AA seq 403 aa AA seqDB search
MQKPYLESMPDENGFFGKFGGAYLPPQLEATYAEISRAYDKLSKSFDFINELKKIRKHYQ
GRPTPITYCRNLSDFVGGGQIYLKREDLNHTGAHKLNHCMAEALVAKYLGKTKLIAETGA
GQHGVALATAAAYFGLECEIHMGEVDIAKEYPNVVRMKILGAKVVPATHGLKTLKEAVDS
AFDAYLKDTETQLFAIGSVVGPHPFPKMVRDFQSVVGFEAKEQFLEMTGRLPDMVTACVG
GGSNAMGIFSAFIEDSVKLYAVEPAGKGDKIGEHSASLTYGKEGIMHGFNSIMLQDEEGN
PAPVHSIGSGIDYPSVGPEHAYLNSIGRTNIGLCSDTESIDAFYKLSQHEGIIPALESAH
AVAFAMKYAKENPKESILVNLSGRGDKDIDFVVENYPIPTKWA
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaaccctatttggaatctatgcctgatgagaacggcttttttggaaaatttgga
ggtgcgtatcttccgccccaacttgaggctacttatgccgaaataagcagagcatacgac
aagctctcaaaatcttttgattttataaatgagcttaaaaagataagaaaacactatcaa
ggaagacctactcctattacatactgcagaaacctctctgattttgttggcggagggcag
atttatctaaagagagaggatctaaatcacactggcgcacacaagttaaaccactgtatg
gctgaagctcttgtagcaaaataccttggcaaaacaaagctaatcgcagaaacaggagct
ggtcagcatggggtagcattagctactgctgcggcttattttgggcttgagtgtgagata
catatgggcgaagttgatattgccaaagagtatccgaatgttgttagaatgaagatttta
ggtgctaaagtagttccagcaactcatgggttaaaaacacttaaagaggcggttgacagt
gcttttgatgcttatttaaaagatacagagactcaactatttgcaatcggctctgtagtt
ggacctcacccttttccaaaaatggtaagagattttcaaagcgtagtaggatttgaagca
aaagagcagtttttagagatgacgggtcgtcttccagatatggtaactgcatgtgtaggc
ggaggaagcaacgctatgggaattttcagtgcttttattgaagatagtgtaaagctttat
gctgtagagccagctggaaaaggtgataaaattggtgaacatagcgctagtcttacttat
ggtaaagagggcatcatgcatggctttaactctatcatgcttcaagatgaagagggaaat
cccgctccagtgcactctattggaagcggtatagattacccatcagttggacctgaacac
gcttatctaaatagtatcggaagaacaaatatagggctatgcagtgacacagaatcaata
gatgctttttataaactctctcaacatgagggaatcattccagcattagaatctgcacat
gccgtagcctttgctatgaagtacgcaaaagagaatcctaaagagtctattttggtaaat
cttagcggaagaggagacaaagatatagactttgtagttgaaaactatccaattcctaca
aagtgggcgtaa

DBGET integrated database retrieval system