KEGG   Sulfurimonas denitrificans: Suden_0789Help
Entry
Suden_0789        CDS       T00298                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Suden_0789
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Suden_0789
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Suden_0789
Enzymes [BR:tdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Suden_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
818616..820088
Genome map
AA seq 490 aa AA seqDB search
MNFIQTRGCDATKVKSVTFSEAILNPIASFGGLYVPEALPSLGEAFLKKHLNSSYKELAS
DMLSRFEIDIDKHVIDEALNLYDRFDNPKNPVPVVRVKENLYVSELYHGPTRAFKDMALQ
PFGVVLSSIAQKRDEHYLILAATSGDTGPAALETFKNRANVQVACLYPDGGTSDVQRLQM
VTEDAKNLKVIGINGVFDDAQNALKRLLASDDFKSALKKKNILLSAANSVNFGRIIFQII
YHIHSYLELVRQGAILMGEKVYLNVPSGNFGNALGAYYAWKMGLGVEKIIISSNENNVLT
KLIKTGKYDLRDLHVVSTTSPAMDILKSSNVERILFDMFGFERTKELMQDLESKNFYELN
ADELSKLQESFDADFCNGDEGKKYIKDTFYNNGYLMDPHTATCLKSYETCSNPKIKTIAY
STAEWTKFSPVIANALTGEVDAQDIIALESISKEAKLEIPAMVKALFTKPIVQKVVIEKE
DIEKEILKFI
NT seq 1473 nt NT seq  +upstreamnt  +downstreamnt
atgaactttattcaaacccgtggatgtgacgcaactaaagtaaaaagtgtaacattctca
gaagctatcttaaacccaatcgcctcttttggaggtctttatgtgcctgaggctttgccc
tctttaggagaggcttttttaaagaaacatttaaactcttcatataaagagttggcatct
gacatgttaagccgttttgagatagatattgataaacatgtaattgacgaagcgctaaac
ctttatgataggtttgataatccaaaaaatccagtccctgtcgtaagagtgaaagagaat
ctatatgtaagcgaactctatcatggtccaacacgtgcttttaaagatatggctctacaa
ccttttggagtcgtattatcttctattgcgcaaaaaagagatgagcactatcttattttg
gcggcaactagtggcgatacaggtccagctgcactagagacttttaaaaacagagcaaat
gttcaagttgcatgtctctatcctgatggcggaacaagtgatgttcaaagactacaaatg
gttacagaagatgcaaaaaatctaaaagtaattggaataaatggcgtttttgatgatgcg
caaaatgcactaaagagacttttggcttcagatgattttaaatcagctctaaagaaaaaa
aacattcttctctcggctgcaaactctgtaaactttgggcgtattatttttcaaataatt
taccatattcatagctatttagagcttgtccgtcaaggtgctattcttatgggtgagaag
gtttacttaaatgttccaagtggaaattttggaaatgcacttggtgcttactatgcttgg
aaaatgggacttggggttgaaaaaatcataatatcttcaaatgaaaataatgttcttacg
aaacttattaaaactggaaaatatgatttaagagacttacatgtagtaagtacaacttct
ccagcgatggatatattaaaatcttcaaatgttgagagaattttatttgatatgtttggt
tttgagagaacaaaggagttgatgcaagacttggagtcaaagaatttttatgagttaaat
gcagatgagcttagcaaacttcaagagagctttgatgctgatttttgtaacggcgatgag
ggtaaaaaatatataaaagatacattttataataatggttatcttatggatccccatact
gccacatgtttaaaatcttacgagacttgttcaaatcctaaaataaaaacaattgcttac
tcaacagcagagtggactaagttttctccagtaatagctaatgcgctaactggggaagtt
gatgcacaggatattatagcacttgaatcaatctctaaagaggcaaagcttgaaattcct
gctatggtaaaagctctttttacaaagccgattgttcaaaaagtggttattgaaaaagaa
gatatagaaaaagagatattgaagtttatataa

DBGET integrated database retrieval system