KEGG   Sulfurimonas denitrificans: Suden_0978Help
Entry
Suden_0978        CDS       T00298                                 

Definition
response regulator receiver (CheY-like) modulated CheB methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Suden_0978
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Suden_0978
Enzymes [BR:tdn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Suden_0978
Two-component system [BR:tdn02022]
 CheA family
  CheA-CheYBV
   Suden_0978
Bacterial motility proteins [BR:tdn02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Suden_0978
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1022622..1023680
Genome map
AA seq 352 aa AA seqDB search
MAIRVLIVDDSATARTVLKDVLSKDSEIEVIATAPDAYVARDKIVQLKPDVICLDVEMPR
MDGISFLKKIMKYFPTPVLMVSSLTQDGAQVTFDALEAGAIDYVAKPHSNIYDGIDEIQK
ELIQKVKMVASSNLSARIEAAKAKTSTLEYKPKATYSLAQTTNKLIAIGASTGGTVALAE
LIARFTKDTPGVVVVQHMPSGFTNSFAQRLNSLCEVEVKEAEDGDIIGRGRVLVAPGDLH
MVVRRDGGNYRVKLGTGEKISGHRPSVDVLFNSVASHVGSNAIGVLLTGMGSDGAKGMLK
MKTSGASTIAQDEKSSIVWGMPKVAYEIGAVDFVEPLSNIDVKIASLLSERK
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
gtggcaattagagttctaatagtagatgatagcgcaacagctagaacagtcctaaaggat
gttctaagtaaagatagcgagatagaagtaattgccacagcacccgatgcttatgtagca
agagataagatagttcaactaaaaccagatgttatctgtcttgatgttgagatgccacga
atggatggaatcagctttttaaaaaagattatgaagtactttcctactccagttttaatg
gtatcttcacttactcaagatggagcgcaagttacttttgatgcgcttgaagctggagca
atagactatgttgcaaaacctcactcaaatatttatgatggtatagatgagatacaaaaa
gagctaatccaaaaagtaaaaatggtagcctcttcaaatttaagtgcaagaatagaagcc
gcaaaagcaaaaacttcaacgctggagtataaaccaaaagctacatactctctagctcaa
actacaaacaaactcatagccattggtgcatcaactggcggaacagtggcactagctgag
ctaatcgcccgttttacaaaagatacaccaggggttgtggttgttcaacatatgccaagc
gggtttacaaactcttttgcacagaggcttaactctctttgtgaggttgaagtaaaagag
gcagaagatggcgacattatagggcgtggaagagttcttgttgctccaggagatttgcac
atggtggtgcgaagagatggcggaaactatagagtaaagctaggaactggcgagaagata
agcggacatagaccctcagttgatgttttgtttaactcagttgcctctcatgttggttca
aatgccataggtgtactcttaacaggtatgggaagtgatggagcaaaggggatgttaaag
atgaaaacaagcggtgcttcaacaatcgctcaagatgagaaaagctctattgtgtgggga
atgccaaaggttgcttatgagattggcgctgttgattttgtagagccactctctaacata
gatgtaaaaatagcatcacttcttagtgagagaaagtaa

DBGET integrated database retrieval system