KEGG   Sulfurimonas denitrificans: Suden_1050Help
Entry
Suden_1050        CDS       T00298                                 

Gene name
sucC
Definition
succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Suden_1050 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Suden_1050 (sucC)
   00640 Propanoate metabolism
    Suden_1050 (sucC)
   00660 C5-Branched dibasic acid metabolism
    Suden_1050 (sucC)
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Suden_1050 (sucC)
Enzymes [BR:tdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Suden_1050 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1115421..1116596
Genome map
AA seq 391 aa AA seqDB search
MNIHEYQAKQIFAKYGVPTPKGLMAESVKQAVANAETLGGSIWVVKAQIHAGGRGLGGGV
KLARSLEEVEQLSKEILGMTLVTHQTGPEGKLVQKLYIEEGADIKEELYLGVVLDRAREM
PVIMASTEGGMAIEDVAHNTPEKIIKIAVDPAIGFQGFHGRELVFGLGITDPNEQKKLIS
FASKLYKLYMENDAEMIEINPLVKTGSGEFLALDGKMGFDDSALGRHPDIEDMRDISEED
ADEREAGKYGLSYVSLDGEIGCMVNGAGLAMGTMDTINYMGGTPANFLDVGGKANAETVA
KGFEIILKNPKVKAIFVNIFGGIVRCDRIANGILEATKLVDVHVPVIVRLDGTNAEEAAA
ILRDANIANVIAATDLADGAAKAVAAAAQAK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacatgagtatcaagcgaaacagatttttgcaaagtacggcgtaccaactcca
aaaggtttgatggctgagagtgtaaaacaagcagttgctaatgcagagacattaggtggt
tctatttgggttgtaaaagcccaaatccatgcaggaggaagaggtcttggtggcggtgta
aaacttgctcgttcattagaagaagtagagcagttatctaaagaaattttaggtatgact
ctagtaactcatcaaacaggacctgagggtaaacttgttcaaaagctctacattgaagag
ggcgctgatattaaagaggagttatatcttggtgttgttcttgatcgtgctcgtgaaatg
ccagtaattatggcttcaactgagggtggtatggctatcgaagatgttgctcacaatact
ccagagaagattatcaaaatagcagtagatccagctatcggttttcaaggtttccatgga
agagaacttgtatttggtttaggtattactgatccaaatgagcaaaaaaaacttataagt
tttgcttcaaaactatataaactctatatggaaaatgatgcagaaatgatagaaatcaac
cctcttgtaaaaactggaagcggtgaatttttagcacttgatggaaagatgggatttgat
gattctgctcttggtcgccaccctgatattgaagatatgagagatataagtgaagaggat
gctgatgagcgtgaagctggtaaatatggtctctcttatgtaagtcttgatggcgaaatc
ggctgtatggtaaatggagcagggcttgctatgggaacaatggatactatcaactacatg
ggcggaacacctgcaaacttcttggatgttggcggaaaagctaatgctgagacagttgca
aaaggatttgagattattcttaaaaatccaaaagttaaagctatatttgtaaatattttt
ggtggaattgttagatgtgatcgtattgcaaatggtatcttagaagctactaagcttgta
gatgttcatgttcctgtaatagttcgtcttgatggtacaaatgcagaagaagcagcagcg
attttaagagatgcaaacattgcaaatgttatagcagctacagatttagctgatggtgct
gcaaaagcagtagcagctgctgcgcaagctaagtaa

DBGET integrated database retrieval system