KEGG   Sulfurimonas denitrificans: Suden_1050Help
Entry
Suden_1050        CDS       T00298                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00020  Citrate cycle (TCA cycle)
tdn00640  Propanoate metabolism
tdn00660  C5-Branched dibasic acid metabolism
tdn00720  Carbon fixation pathways in prokaryotes
tdn01100  Metabolic pathways
tdn01110  Biosynthesis of secondary metabolites
tdn01120  Microbial metabolism in diverse environments
tdn01130  Biosynthesis of antibiotics
tdn01200  Carbon metabolism
Module
tdn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tdn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
tdn_M00173  Reductive citrate cycle (Arnon-Buchanan cycle)
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Suden_1050
   00640 Propanoate metabolism
    Suden_1050
   00660 C5-Branched dibasic acid metabolism
    Suden_1050
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Suden_1050
Enzymes [BR:tdn01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Suden_1050
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp DUF1983
Motif
Other DBs
NCBI-ProteinID: ABB44328
JGI: Tmden1050
UniProt: Q30RQ3
Position
1115421..1116596
Genome map
AA seq 391 aa AA seqDB search
MNIHEYQAKQIFAKYGVPTPKGLMAESVKQAVANAETLGGSIWVVKAQIHAGGRGLGGGV
KLARSLEEVEQLSKEILGMTLVTHQTGPEGKLVQKLYIEEGADIKEELYLGVVLDRAREM
PVIMASTEGGMAIEDVAHNTPEKIIKIAVDPAIGFQGFHGRELVFGLGITDPNEQKKLIS
FASKLYKLYMENDAEMIEINPLVKTGSGEFLALDGKMGFDDSALGRHPDIEDMRDISEED
ADEREAGKYGLSYVSLDGEIGCMVNGAGLAMGTMDTINYMGGTPANFLDVGGKANAETVA
KGFEIILKNPKVKAIFVNIFGGIVRCDRIANGILEATKLVDVHVPVIVRLDGTNAEEAAA
ILRDANIANVIAATDLADGAAKAVAAAAQAK
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgaatatacatgagtatcaagcgaaacagatttttgcaaagtacggcgtaccaactcca
aaaggtttgatggctgagagtgtaaaacaagcagttgctaatgcagagacattaggtggt
tctatttgggttgtaaaagcccaaatccatgcaggaggaagaggtcttggtggcggtgta
aaacttgctcgttcattagaagaagtagagcagttatctaaagaaattttaggtatgact
ctagtaactcatcaaacaggacctgagggtaaacttgttcaaaagctctacattgaagag
ggcgctgatattaaagaggagttatatcttggtgttgttcttgatcgtgctcgtgaaatg
ccagtaattatggcttcaactgagggtggtatggctatcgaagatgttgctcacaatact
ccagagaagattatcaaaatagcagtagatccagctatcggttttcaaggtttccatgga
agagaacttgtatttggtttaggtattactgatccaaatgagcaaaaaaaacttataagt
tttgcttcaaaactatataaactctatatggaaaatgatgcagaaatgatagaaatcaac
cctcttgtaaaaactggaagcggtgaatttttagcacttgatggaaagatgggatttgat
gattctgctcttggtcgccaccctgatattgaagatatgagagatataagtgaagaggat
gctgatgagcgtgaagctggtaaatatggtctctcttatgtaagtcttgatggcgaaatc
ggctgtatggtaaatggagcagggcttgctatgggaacaatggatactatcaactacatg
ggcggaacacctgcaaacttcttggatgttggcggaaaagctaatgctgagacagttgca
aaaggatttgagattattcttaaaaatccaaaagttaaagctatatttgtaaatattttt
ggtggaattgttagatgtgatcgtattgcaaatggtatcttagaagctactaagcttgta
gatgttcatgttcctgtaatagttcgtcttgatggtacaaatgcagaagaagcagcagcg
attttaagagatgcaaacattgcaaatgttatagcagctacagatttagctgatggtgct
gcaaaagcagtagcagctgctgcgcaagctaagtaa

DBGET integrated database retrieval system