KEGG   Sulfurimonas denitrificans: Suden_1119Help
Entry
Suden_1119        CDS       T00298                                 

Definition
(GenBank) tryptophan synthase, beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00260  Glycine, serine and threonine metabolism
tdn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tdn01100  Metabolic pathways
tdn01110  Biosynthesis of secondary metabolites
tdn01130  Biosynthesis of antibiotics
tdn01230  Biosynthesis of amino acids
Module
tdn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Suden_1119
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Suden_1119
Enzymes [BR:tdn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Suden_1119
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP DUF1971
Motif
Other DBs
NCBI-ProteinID: ABB44397
JGI: Tmden1119
UniProt: Q30RI4
Position
1172301..1173500
Genome map
AA seq 399 aa AA seqDB search
MYIPSASKFDPKNGHFGIFGGRYVPETLMPALLKLEQEYESIRFDKDFWSEVDYYLVDYV
GRPSPLYYAKNISDELGAKIYLKREDLNHTGAHKVNNVIAQGLMAKRLGYKKIIAETGAG
QHGVATATICALLDLECEIFMGAKDVARQELNVFRMKLLGAKVNSVESGSKTLKDAMNDA
IRHWVTNARDTFYIIGTVAGPHPYPMMVRDFQAIIGYEARAQILKKEGRLPDHVIACIGG
GSNAIGMFQHFLEDKEVECIGIEAGGHGIETLEHGCSLEKGRAGVLHGQMSYLLQDEDGQ
VQEAYSISAGLDYPGIGPEHAFHFENKSVSYNHATDQEALDAFVWLSRKEGIIPAFESAH
AVAYLKKMPNIKNKLIIVNLSGRGDKDMIQAKNILNFDN
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtacattccatcagcttcaaaatttgatccaaaaaatggtcacttcggcatctttggc
ggtagatatgtacctgagactcttatgcctgcacttttaaaactagaacaagagtatgaa
agtatccgctttgacaaagatttttggagtgaagtggactactatcttgtagattatgta
ggtcgcccttccccgctctactatgcaaaaaatatatctgatgaacttggtgcaaaaatc
tatctaaaaagagaagatttaaaccatacaggggcacataaagttaataacgttattgct
caaggtcttatggcaaaacgtcttggatataaaaaaatcatagctgaaactggagctggt
caacatggagtagcaactgctactatctgcgcacttctagatttagagtgtgagatattt
atgggtgcaaaagatgtagctcgtcaggaacttaacgtttttcgtatgaaacttcttggt
gcaaaagtaaatagtgtcgagagcggaagcaaaactctaaaagatgctatgaatgatgca
atccgtcactgggtaacaaatgcaagagatactttttacattatcggaacagttgcaggt
ccgcatccatatcctatgatggttagagattttcaagctattatcggttatgaagcaaga
gcacagatacttaaaaaagagggtcgtttaccagaccatgttatagcatgtataggcgga
ggaagcaacgctattggtatgtttcaacactttttagaagataaagaggttgagtgtatt
ggtatagaagctggcggtcatggtatagagacactggagcatggatgctcacttgagaaa
ggcagagctggagtacttcatgggcagatgagctatcttcttcaagatgaagatgggcag
gttcaagaggcatactctatctcagctggacttgattatcctggaattggacccgaacat
gcgtttcattttgaaaataaaagcgtaagttataatcatgcaacagatcaagaagctcta
gatgcatttgtttggctctcacgcaaggagggaattattcccgcatttgagagcgcacat
gcagtagcttaccttaaaaaaatgccaaatataaaaaataaacttatcattgttaacctt
tcaggcagaggcgacaaagatatgattcaagcaaaaaatatattaaattttgataactaa

DBGET integrated database retrieval system