KEGG   Sulfurimonas denitrificans: Suden_1228Help
Entry
Suden_1228        CDS       T00298                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:tdn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1296087..1296995
Genome map
AA seq 302 aa AA seqDB search
MKKIEKLIEHLNLIYYEYDRATHSFILDRSYSNEHVFEELIKITYILSKHNINFFVDENK
SLILNSKNSFSLKIKRVMNSFIQNLKNRSLNIYVLNDKKVKWAKNLPVIKIETINTTFNI
SSYDALIFTSKSAVYTLNSYNTEWKSKPLYVIAPQTAKVASNLGGKIKFVSRENHGDEFA
DELIPLLKNKKVLYVRGSKVVSNLVEKLNANDVICDEVIVYQTVCSELKKKIKLPKNSVI
IFSSPSTIECFLKNVSWDESYKAVSIGHTTQKYFPPYITPVVADTPSLDSCVKKAIELIS
EK
NT seq 909 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagattgaaaaattaattgagcacttaaatcttatatattatgagtatgataga
gctacccactcgtttatacttgatagaagctactcaaatgagcatgtatttgaggagctt
attaaaataacatatattttaagcaaacataatataaatttttttgtagatgaaaataaa
tctttaattttaaacagcaaaaatagtttttctttaaaaataaaaagagttatgaactct
tttatacaaaatttaaaaaatagatctttaaatatctatgttcttaatgacaaaaaagta
aaatgggctaaaaacttacctgtcataaagatagagacgataaatacaacttttaacatc
tcatcttatgatgctttgatttttacttcaaaaagcgctgtatataccttaaattcatac
aatacagagtggaagagcaaacctctttacgtaatagctcctcaaactgcaaaagtagct
agcaatctaggtggtaagataaaatttgtaagcagagagaatcatggagatgagtttgct
gatgaattaattcctcttttaaaaaacaaaaaagttctatatgtacgaggttctaaagtt
gtctcaaatttggtagagaagcttaatgcaaatgatgtcatttgtgatgaagttatagtt
taccaaactgtatgttcagagttaaaaaagaagataaaacttccaaaaaactctgtaatt
atcttctcctctccatctacgatagagtgtttcttaaaaaatgtctcttgggatgagagt
tataaagctgtatctatcggtcatactactcaaaaatattttccaccatacataactcct
gtcgtcgctgatacaccttcactcgattcatgcgtaaaaaaagccatagagttgatatcc
gaaaagtag

DBGET integrated database retrieval system