KEGG   Sulfurimonas denitrificans: Suden_1284Help
Entry
Suden_1284        CDS       T00298                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tdn  Sulfurimonas denitrificans
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Suden_1284 (recR)
DNA repair and recombination proteins [BR:tdn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Suden_1284 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1356439..1357008)
Genome map
AA seq 189 aa AA seqDB search
MSESLEKFNKLVEAFQELPTIGKKSAIRLAYHIVMKNSFVGIKIAHAIEEALGSIKQCAA
CGGMSEDELCFICCDESRDETLLCIVENAKDILLLEENRLFDGRYFVLDSLENFNLSGLE
SLVKNGVEEIVFALTPSIANDAVILYIEDKLSDFTINFSKIAQGVPTGVSLENIDLLSLS
RALIDRVKV
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaatctttagagaagttcaataaactagttgaagcatttcaagagcttccaaca
attggcaaaaaatcagcaataagactagcttatcatattgttatgaaaaatagttttgtt
ggtataaagatagcccatgctatagaagaagcactaggaagcattaaacagtgcgcagcg
tgtggtggcatgagtgaggatgaactctgctttatatgttgtgatgagagcagggatgag
acacttctttgtattgttgaaaatgcaaaagacattcttcttttagaagaaaacagactt
tttgatggaaggtattttgttttggattcacttgaaaactttaacctttctggtttagag
agtttagttaaaaatggcgttgaggagattgtttttgcattaacgccatctattgcaaat
gatgctgttatactatatattgaagataaattaagtgattttactataaacttttcaaaa
attgctcaaggagtaccaactggagtaagcttagaaaatattgatttattatctttaagt
agagcattaatagacagagtgaaggtataa

DBGET integrated database retrieval system