KEGG   Sulfurimonas denitrificans: Suden_1289Help
Entry
Suden_1289        CDS       T00298                                 

Definition
hypothetical protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Suden_1289
Enzymes [BR:tdn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Suden_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1360659..1361249
Genome map
AA seq 196 aa AA seqDB search
MNKEHLTNKLSSLALSMFRKDFFGIFHGSISAKTESNRFIINTKEAIFDALDNSSLIELY
YKKDYRWNQASIDSNIHHSIYSQISDAKFICFSMPPFTTAYSLDHNVIIPRDYFGYSEIG
SIDIFDPRNFDDWYERASSEIAYYFQSKKSDIMVIRGYGVYTYNRDIHEMAKKIAILEKS
CRLLLLDNAQKDSSFD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaagaacatcttacgaacaaactatcttctttagcactctcgatgtttagaaaa
gatttctttggcatttttcatggctctatatctgctaagactgaatccaatcgctttatc
ataaatacaaaagaggctatttttgatgcacttgacaactcttcacttatagagctttac
tacaaaaaggattatcgctggaatcaagcaagcattgactccaatatacatcatagtatc
tattcacagatatctgatgcaaaatttatctgctttagcatgccgccatttacaaccgct
tactcattagaccacaatgtaataattccacgagactattttggatacagtgaaataggc
tcaattgatatatttgatcctagaaattttgatgattggtatgagcgcgcaagtagcgaa
attgcttactattttcaaagtaaaaagagcgacataatggttattcgtggttatggagtt
tatacctacaatagagatatccatgagatggcaaaaaaaattgcaatcctagagaaaagt
tgcagacttcttctcttagacaatgcacaaaaagactcatcttttgattaa

DBGET integrated database retrieval system