KEGG   Sulfurimonas denitrificans: Suden_1298Help
Entry
Suden_1298        CDS       T00298                                 

Definition
nitrous-oxide reductase (EC:1.7.99.6)
Orthology
K00376  
nitrous-oxide reductase [EC:1.7.2.4]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Nitrogen metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:tdn00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1369244..1371841
Genome map
AA seq 865 aa AA seqDB search
MTKHSKILVSLLVGASVAVSVSSADGELQKVMKARGLSEVDVVRAAKTYNPSGVKDEFVV
FSSAGQAGQVIVYGVPSMRILKYIGVFTPEPWQGYGFDEESKKVLRQGNIRGREINWGDT
HHPALSEKDGKYDGKWLAINDKANPRIAIIDLADFETKQIVVNPVFKSAHGGAFFTQNSD
YIIEACQYAAPLDNNYHPIEDYKEAYRGGATMWRFDPAKGKINVKESFTIEMPPYMQDLS
DSGKGVSDGWGFTNSFNSEMYTGGIEVGMPPNEAGMSRNDTDFLHVYNWKKLAELAKDSK
NVKIINDHKVIPMDIAVKNNALFLIPEPKSPHGVDVSPDGEYITVCGKLDTHASVYKWSN
IKKLIDAKEYAGKDPYGIPILDMKKSLHGQAELGLGPLHNQYSNIDGEIYTSLYVDSQIV
KWNYKTLKVIDKVNVHYNVGHLCGMEGKSADPQGKYIISLNKLAIDRFQNVGPLHPQNHQ
LIDISGKKMDLLVDMPLPLGEPHQAVAIRAEKLHGHVRYPMGTNTRTDEIHEGKTLAGQE
RIERNGNKVTVYATVVRSHINPERITVNKGDEVTFYLTNLERAQDEAHGFTVDHYNIHAS
LEPGKTASLKFIADIEGVFPYYCTEFCSALHLEMMGYMMVKDPNKKYESAQKMKMQTMTP
EQLKAEYDKTVATNAATDAVIQSVVKFLKENKYEKHKVVADLVADAFVQYGQIPDQKKLA
DKSLKDGDIEKAILFENMIWQLMVKTADVGIRAKDALVRLVATKQSAAASAGEKAFGEGG
CGGCHVIGKVSSGPDLTGVLQRHGANGEKWVKDFIMNPEKMYDEPYVKGMIDYFNLRMPN
QHMDEKETKNIIEYLKWVDDNANLF
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgactaagcattctaaaatacttgtttcgcttctagttggtgcatctgtagctgtgagt
gtgtcctcagctgatggtgaactacaaaaagttatgaaagcaagaggactgagtgaagta
gatgtggttcgcgctgcaaaaacttataacccttcaggcgttaaagatgaattcgttgta
tttagttcagctggtcaagctggacaagttatcgtttatggtgttccatcaatgagaatt
ttaaaatacatcggtgtatttacacctgaaccttggcaaggatacggatttgacgaagag
tcaaaaaaagttctaagacaaggtaatataagaggaagagagattaactggggagatact
caccaccctgctctttcagaaaaagatggaaaatatgatggtaaatggttagctataaat
gataaagcaaatcctcgtattgctattattgacttagctgactttgaaacaaaacagata
gttgtaaaccctgtttttaaatcagctcatggtggtgctttctttactcaaaacagtgat
tatattattgaggcgtgtcagtacgctgctcctcttgataataactatcacccaattgaa
gactacaaagaagcttaccgtggtggtgctactatgtggagatttgatcctgctaaaggt
aaaatcaacgtaaaagagtcatttactattgaaatgcctccatatatgcaagatttaagt
gattcaggtaaaggtgtgtctgatggatggggctttacaaactcatttaactctgaaatg
tacacaggtggaatcgaagttggtatgccaccaaacgaagctggtatgagtagaaatgac
actgactttttacatgtatataattggaagaaacttgcagaacttgcaaaagattctaaa
aatgtaaaaatcattaatgatcataaagttatacctatggatattgcagttaaaaacaat
gctctattcttaattccagaaccaaaatcacctcacggtgttgacgtttctccagatgga
gagtatattacggtttgtggtaagctagatactcatgcttctgtatataaatggagcaat
attaaaaagcttattgatgctaaagagtatgctggtaaagacccatacggcattccaatt
ttagatatgaaaaaatcactacatggacaagctgaattaggtctggggccattgcataac
caatattcaaacatagatggtgaaatttatacatctttatatgttgatagtcaaattgta
aaatggaactataaaacacttaaagttatagataaagtaaacgttcactataacgttggt
cacttatgtggaatggaaggtaaatcagcagatcctcaagggaaatatatcatctctcta
aataaattagcgattgatagattccaaaatgttggtccacttcacccacaaaatcaccag
ttgattgatattagcggtaaaaaaatggatcttcttgttgatatgcctcttcctttaggt
gagcctcaccaagcagttgcaatcagagcagagaagcttcatgggcatgtaagatatcct
atgggtactaacactagaactgatgagattcacgaaggtaaaacacttgctggtcaagag
agaattgagagaaatggaaacaaagtaacagtatatgcaactgttgttcgctcacatatc
aatccagaaagaattactgtaaataaaggtgatgaagttacattctatctaacaaactta
gagcgtgcacaagatgaggctcatggatttactgtggatcactataatattcacgcttca
cttgagccgggtaaaactgcaagtcttaagtttatagctgatattgagggagtatttcct
tactattgtacagagttctgttctgcgcttcacttagaaatgatgggttatatgatggtt
aaagacccaaataaaaagtacgaaagtgctcaaaaaatgaaaatgcaaacaatgactcct
gagcagttaaaagctgaatatgacaaaactgttgcaacaaatgctgctactgacgctgtt
atccagtctgttgttaagttcttaaaagagaacaaatatgagaaacataaagttgtagct
gatcttgtagctgatgcttttgttcaatatggtcaaattcctgatcaaaagaaattagct
gataaatctctaaaagatggtgatattgaaaaagctattctttttgaaaatatgatttgg
cagttaatggttaaaacagcagacgttggtattagagcaaaagacgcacttgttagactt
gttgctacaaaacaatcagctgcggcatctgctggtgaaaaagcatttggagaaggcggt
tgtggcggttgtcacgttatcggtaaagtttcgtctggtccagacttaacaggtgttctt
caaagacatggtgctaatggagagaaatgggttaaagatttcattatgaatcctgaaaag
atgtatgatgagccttatgtaaaaggtatgattgattactttaacttaagaatgcctaat
cagcatatggatgaaaaagagactaaaaacattattgaatacctaaaatgggtagatgat
aacgcaaatttattctaa

DBGET integrated database retrieval system