KEGG   Sulfurimonas denitrificans: Suden_1445Help
Entry
Suden_1445        CDS       T00298                                 

Definition
(GenBank) succinyldiaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tdn  Sulfurimonas denitrificans
Pathway
tdn00300  Lysine biosynthesis
tdn01100  Metabolic pathways
tdn01120  Microbial metabolism in diverse environments
tdn01230  Biosynthesis of amino acids
Module
tdn_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Suden_1445
Enzymes [BR:tdn01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Suden_1445
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: ABB44722
JGI: Tmden1445
UniProt: Q30QK9
Position
complement(1512687..1513784)
Genome map
AA seq 365 aa AA seqDB search
MKTIELFKFMISAKSQTPDDGGLLDFIQNYLDDFEAIRVDVEGVKNLFLYKKFSQGDHLC
FAGHVDVVPAGDGWDSDPYIATERDGYIYGRGAQDMKSGVAAFVQAIKDTKHFNGTLSLL
LTSDEEGEGTYGTIEVLNYLRDKSMLPDFAVVAEPTCEMVFGDAIKVGRRGSINGYITLR
GKQGHAAYPEKSINPINLIAPKLANMAGVDLDNGDEFFSPSKFVITDIRAGMQVTNVTPN
ELKMMFNVRNTTLTSQKEIREFVEKNLEDLDYDLRLTQGSYPFKTDTKTKLVKNIDASIE
QISGIKPKHSTAGGTSDARHMAPLGIDVIEFGVINDTIHAINERTTKDEVKKLYEVFKHL
IDTWK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattgaactttttaaatttatgataagcgcaaagagccaaactccagatgat
ggcggacttttagattttatacaaaactatttagatgattttgaagcgattagagttgat
gttgagggtgttaaaaacctctttttatataaaaaattctcacaaggagatcacctctgt
ttcgctggacatgtagatgttgttcctgctggtgatggatgggatagcgacccatatatt
gcaacagagagagatggttatatatatggacgtggtgcgcaagatatgaagagtggcgtc
gcagcatttgttcaagctataaaagatactaaacattttaatggaactctatccttacta
ctaacttcagacgaagagggagagggaacatacggcacaatcgaggttttaaactacctt
agggataaaagtatgctcccagattttgcagttgttgcagagcctacatgtgagatggtt
tttggtgatgctataaaagtagggcgcagaggttcaatcaatggctatataactctaaga
gggaagcaaggacacgccgcataccccgaaaaatctataaaccctataaatctaatcgca
ccaaaacttgcaaatatggctggtgtagatttggataacggtgatgagtttttttctcca
agcaaatttgttataacagatattagagctgggatgcaggttacaaatgtaactccaaat
gaacttaagatgatgtttaatgtaagaaatactactcttacttctcaaaaagagattaga
gagtttgttgagaaaaacttagaagatttagattatgatttgcgccttactcaaggctct
tatccttttaaaacagatactaaaacaaagcttgttaaaaatattgatgcctccattgag
caaatcagtggcataaaaccaaaacactcaaccgctgggggaacttcagacgcaagacat
atggctccgcttggcatagacgttatagaatttggcgtaataaatgatacaattcacgct
ataaatgagcgaaccacaaaagatgaggttaagaaactttatgaagtttttaagcatctt
atagatacgtggaaataa

DBGET integrated database retrieval system