KEGG   Sulfurimonas denitrificans: Suden_1445Help
Entry
Suden_1445        CDS       T00298                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tdn01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis [PATH:tdn00300]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1512687..1513784)
Genome map
AA seq 365 aa AA seqDB search
MKTIELFKFMISAKSQTPDDGGLLDFIQNYLDDFEAIRVDVEGVKNLFLYKKFSQGDHLC
FAGHVDVVPAGDGWDSDPYIATERDGYIYGRGAQDMKSGVAAFVQAIKDTKHFNGTLSLL
LTSDEEGEGTYGTIEVLNYLRDKSMLPDFAVVAEPTCEMVFGDAIKVGRRGSINGYITLR
GKQGHAAYPEKSINPINLIAPKLANMAGVDLDNGDEFFSPSKFVITDIRAGMQVTNVTPN
ELKMMFNVRNTTLTSQKEIREFVEKNLEDLDYDLRLTQGSYPFKTDTKTKLVKNIDASIE
QISGIKPKHSTAGGTSDARHMAPLGIDVIEFGVINDTIHAINERTTKDEVKKLYEVFKHL
IDTWK
NT seq 1098 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacaattgaactttttaaatttatgataagcgcaaagagccaaactccagatgat
ggcggacttttagattttatacaaaactatttagatgattttgaagcgattagagttgat
gttgagggtgttaaaaacctctttttatataaaaaattctcacaaggagatcacctctgt
ttcgctggacatgtagatgttgttcctgctggtgatggatgggatagcgacccatatatt
gcaacagagagagatggttatatatatggacgtggtgcgcaagatatgaagagtggcgtc
gcagcatttgttcaagctataaaagatactaaacattttaatggaactctatccttacta
ctaacttcagacgaagagggagagggaacatacggcacaatcgaggttttaaactacctt
agggataaaagtatgctcccagattttgcagttgttgcagagcctacatgtgagatggtt
tttggtgatgctataaaagtagggcgcagaggttcaatcaatggctatataactctaaga
gggaagcaaggacacgccgcataccccgaaaaatctataaaccctataaatctaatcgca
ccaaaacttgcaaatatggctggtgtagatttggataacggtgatgagtttttttctcca
agcaaatttgttataacagatattagagctgggatgcaggttacaaatgtaactccaaat
gaacttaagatgatgtttaatgtaagaaatactactcttacttctcaaaaagagattaga
gagtttgttgagaaaaacttagaagatttagattatgatttgcgccttactcaaggctct
tatccttttaaaacagatactaaaacaaagcttgttaaaaatattgatgcctccattgag
caaatcagtggcataaaaccaaaacactcaaccgctgggggaacttcagacgcaagacat
atggctccgcttggcatagacgttatagaatttggcgtaataaatgatacaattcacgct
ataaatgagcgaaccacaaaagatgaggttaagaaactttatgaagtttttaagcatctt
atagatacgtggaaataa

DBGET integrated database retrieval system