KEGG   Sulfurimonas denitrificans: Suden_1463Help
Entry
Suden_1463        CDS       T00298                                 

Definition
(GenBank) acyl-[acyl-carrier-protein]--UDP-N-acetylglucosamine O-acyltransferase
  KO
K00677  
UDP-N-acetylglucosamine acyltransferase [EC:2.3.1.129]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Cationic antimicrobial peptide (CAMP) resistance
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    Suden_1463
 Human Diseases
  Drug resistance
   01503 Cationic antimicrobial peptide (CAMP) resistance
    Suden_1463
Enzymes [BR:tdn01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.129  acyl-[acyl-carrier-protein]---UDP-N-acetylglucosamine O-acyltransferase
     Suden_1463
Lipopolysaccharide biosynthesis proteins [BR:tdn01005]
 Lipid A
  Suden_1463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1534164..1534949
Genome map
AA seq 261 aa AA seqDB search
MSKISPLAIIEDGAVIGKDVEIGAYCIISSDSTIGDGTKIEQNSCIYGKTTIGKNNHIFS
HAVIGSAPQDLKFAGEDVELIIGDNNKIREFTLFNPGTKGGGGKTIIGSHNLFMGYVHIG
HDVIIGNHCILANAATLAGHVEMGDYAVIGGMTPIHQFVHIGEYAMVAGASALAQDVPPF
CMAEGNRATLRGLNLTGLRRNIEREEIDEIKSAYKELFEAGKPLKDVANEILEHTSSHHV
QSLCNFVLKTKRGIPYERKHL
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaaatttctccactagcaatcatagaagatggtgcagttattgggaaagatgtt
gagataggagcttattgtattatctcttctgactcaactatcggcgatggaacaaagata
gaacaaaacagctgtatttacggcaaaacaactataggcaaaaataatcatattttttca
catgcagttattggctcagctccacaagatcttaaatttgctggtgaagatgttgaacta
atcatcggcgataacaataaaatcagagagtttacactctttaatcctgggacaaaaggc
ggtggaggaaagactatcatcggctcacacaatctttttatgggttatgttcacatagga
cacgatgttatcattggaaaccactgcatcttggcaaatgctgcaactcttgcagggcac
gttgagatgggtgattatgcagtaattggcggaatgactcctattcatcagtttgttcat
atcggtgaatatgctatggtagctggtgcatcagcacttgctcaagatgtacctccattt
tgtatggcagagggaaatcgtgcaacacttagaggacttaacttaacaggtcttagaaga
aacatagagcgtgaagagattgatgagataaaatcagcctacaaagagctttttgaagca
ggaaaacctctcaaagatgttgcaaatgagatacttgaacatacttcaagccatcatgta
caatctctttgtaattttgttcttaaaactaaacgcggtattccgtatgaaaggaaacat
ctatga

DBGET integrated database retrieval system