KEGG   Sulfurimonas denitrificans: Suden_1473Help
Entry
Suden_1473        CDS       T00298                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tdn  Sulfurimonas denitrificans
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tdn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Suden_1473
   00052 Galactose metabolism
    Suden_1473
   00500 Starch and sucrose metabolism
    Suden_1473
   00520 Amino sugar and nucleotide sugar metabolism
    Suden_1473
Enzymes [BR:tdn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Suden_1473
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1545207..1546046)
Genome map
AA seq 279 aa AA seqDB search
MPKENMKIRKCLFPAAGYGTRFLPATKAIPKEMLPILTKPLLQYGVEEAREAGIDTMAIV
TGRGKRAIEDHFDRSFELEHQIDGTSKEILMKEIRDIVKNCTISYTRQGEMKGLGHAIWT
GQTLIGDEPFAVILADDLCDNDGEAVLTQMVKLYEKYRCSIVAVEEIPLEHSNKYGVIAG
HEEEDGVIRVTNMVEKPESKDAPSNLAIIGRYILTPDIFDILEDTKPGKGGEIQITDALL
TQAKTGGVIAYKFKGKRFDCGSVDGFVKATNFFYNKTQE
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgccaaaagagaatatgaaaataagaaaatgccttttcccagcagcgggttatggaaca
aggttccttccagctacaaaggcaatcccaaaagagatgcttcctatccttacaaaaccg
cttttacaatatggtgtggaagaggctagagaagcaggaatagataccatggcaatagta
acaggtcgtggaaaaagagcaattgaagatcactttgacagatcgtttgaacttgagcat
cagatagatggaacttctaaagagatactgatgaaagagatacgtgatattgttaaaaat
tgtactatcagttacacaagacaaggcgaaatgaaagggttgggtcatgctatttggaca
ggacaaacacttattggagatgaaccttttgcagtaattttagcagatgacttgtgtgat
aatgatggtgaggctgttttgacacaaatggtaaaattgtatgaaaaatatagatgctct
attgtagctgttgaagagattccgctagaacatagtaataaatatggagtaattgcggga
catgaagaagaagatggcgttattagagtaacgaatatggttgaaaaaccagagagtaaa
gatgctccttcaaacttagcgataattggaagatatatattgacacctgatatttttgat
attctagaagatactaaacctggaaaaggtggagagattcagataactgatgcactttta
acgcaagcaaaaacgggtggagtaatagcatataaatttaaaggaaaaagatttgattgt
ggaagtgtggatggttttgtaaaggctacaaactttttttacaataaaactcaagagtag

DBGET integrated database retrieval system